Learn More
Adenosine A1R Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258443
Description
Adenosine A1R Polyclonal specifically detects Adenosine A1R in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Adenosine A1R | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ADORA1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN | |
100 μL | |
Apoptosis, GPCR, Growth and Development, Immunology, Innate Immunity, Neuronal Cell Markers, Signal Transduction, Vision | |
134 | |
Human | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
For Research Use Only