Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adenosine A1R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25844325UL
Description
Adenosine A1R Polyclonal specifically detects Adenosine A1R in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Adenosine A1R | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| ADORA1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN | |
| 25 μL | |
| Apoptosis, GPCR, Growth and Development, Immunology, Innate Immunity, Neuronal Cell Markers, Signal Transduction, Vision | |
| 134 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction