Learn More
Adenosine A2aR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | Adenosine A2aR |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Adenosine A2aR Polyclonal antibody specifically detects Adenosine A2aR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Adenosine A2aR | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Apoptosis, GPCR, Immunology, Innate Immunity | |
PBS (pH 7.2) and 40% Glycerol | |
135 | |
IgG | |
Protein A purified |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8 | |
This antibody was developed against a recombinant protein corresponding to amino acids: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.