basic leucine zipper transcription factor, ATF-like, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human BATF protein.

Supplier:  Abnova Corporation H00010538D01P

Catalog No. 89-018-233

Description

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq

Sequence: MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP

Specifications

• Antigen: basic leucine zipper transcription factor, ATF-like
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human BATF protein.
• Gene: BATF
• Gene Alias: B-ATF/BATF1/SFA-2/SFA2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006399.2
• Gene Symbols: BATF
• Immunogen: BATF (NP_006390.1, 1 a.a. ∼ 125 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Gene ID (Entrez): 10538
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG