HEYL, Mouse, Clone: 3D3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant HEYL.

Supplier:  Abnova Corporation H00026508M12

Catalog No. 89-002-617

Description

This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq

Sequence: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV

Specifications

• Antigen: HEYL
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014571
• Gene Symbols: HEYL
• Immunogen: HEYL (NP_055386, 1 a.a. ∼ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA, Western Blot
• Clone: 3D3
• Description: Mouse monoclonal antibody raised against a full length recombinant HEYL.
• Gene: HEYL
• Gene Alias: HRT3/MGC12623/bHLHb33
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 26508
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid