PSARL, Mouse, Clone: 4F4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PSARL.

Supplier:  Abnova Corporation H00055486M02

Catalog No. 89-002-637

Description

This gene encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: AWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIK

Specifications

• Antigen: PSARL
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_018622
• Gene Symbols: PARL
• Immunogen: PSARL (NP_061092.3, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2b κ

• Applications: ELISA
• Clone: 4F4
• Description: Mouse monoclonal antibody raised against a partial recombinant PSARL.
• Gene: PARL
• Gene Alias: PRO2207/PSARL/PSARL1/PSENIP2/RHBDS1
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 55486
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid