TF, Mouse, Clone: 1C2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TF.

Supplier:  Abnova Corporation H00007018M08

Catalog No. 89-002-702

Description

This gene encodes a glycoprotein with an approximate molecular weight of 76.5kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq

Sequence: FVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLF

Specifications

• Antigen: TF
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC059367
• Gene Symbols: TF
• Immunogen: TF (AAH59367, 551 a.a. ∼ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 1C2
• Description: Mouse monoclonal antibody raised against a partial recombinant TF.
• Gene: TF
• Gene Alias: DKFZp781D0156/PRO1557/PRO2086
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 7018
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid