transforming growth factor, beta-induced, 68kDa, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TGFBI.

Supplier:  Abnova Corporation H00007045A01

Catalog No. 89-004-338

Description

This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. Mutations in this gene are associated with multiple types of corneal dystrophy. [provided by RefSeq

Sequence: AHDKRGRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILVS

Specifications

• Antigen: transforming growth factor, beta-induced, 68kDa
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TGFBI.
• Gene: TGFBI
• Gene Alias: BIGH3/CDB1/CDG2/CDGG1/CSD/CSD1/CSD2/CSD3/EBMD/LCD1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Adhesion
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC000097
• Gene Symbols: TGFBI
• Immunogen: TGFBI (AAH00097.1, 481 a.a. ∼ 580 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7045
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.