Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calcium-sensing R/CaSR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$646.00
Specifications
| Antigen | Calcium-sensing R/CaSR |
|---|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Target Species | Human, Mouse |
Description
Calcium-sensing R/CaSR Polyclonal specifically detects Calcium-sensing R/CaSR in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| Calcium-sensing R/CaSR | |
| Rabbit | |
| Human, Mouse | |
| calcium-sensing receptor, CAR, CaSR, EIG8, extracellular calcium-sensing receptor, FHH, FIH, GPRC2AHHC, HHC1, hypocalciuric hypercalcemia 1, NSHPT, parathyroid Ca(2+)-sensing receptor 1, Parathyroid cell calcium-sensing receptor, PCaR1, PCAR1MGC138441 | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI | |
| Primary | |
| Unconjugated | |
| 846 | |
| Immunogen affinity purified | |
| RUO |
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.