Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Cathepsin K |
|---|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Classification | Polyclonal |
Description
Cathepsin K Polyclonal specifically detects Cathepsin K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Cathepsin K | |
| Rabbit | |
| Polyclonal | |
| IgG | |
| cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| Immunocytochemistry, Immunofluorescence | |
| RUO |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF | |
| Primary | |
| Human | |
| Unconjugated | |
| 1513 | |
| Affinity Purified | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.