Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Cathepsin K |
---|---|
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF |
Host Species | Rabbit |
Primary or Secondary | Primary |
Classification | Polyclonal |
Description
Cathepsin K Polyclonal specifically detects Cathepsin K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Cathepsin K | |
Rabbit | |
Polyclonal | |
IgG | |
cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
Immunocytochemistry, Immunofluorescence | |
RUO |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF | |
Primary | |
Human | |
Unconjugated | |
1513 | |
Affinity Purified | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title