Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin K Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | Cathepsin K |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17987820
|
Novus Biologicals
NBP17987820UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP179878
|
Novus Biologicals
NBP179878 |
100 μL |
Each for $487.50
|
|
|||||
Description
Cathepsin K Polyclonal specifically detects Cathepsin K in Human samples. It is validated for Western Blot.Specifications
| Cathepsin K | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| NP_000387 | |
| 1513 | |
| Synthetic peptide directed towards the middle region of human CTSK. Peptide sequence SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD | |
| CTSK | |
| IgG | |
| Affinity Purified | |
| 37 kDa |
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.