Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin K Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | Cathepsin K |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17987820
|
Novus Biologicals
NBP17987820UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP179878
|
Novus Biologicals
NBP179878 |
100 μL |
Each for $487.50
|
|
|||||
Description
Cathepsin K Polyclonal specifically detects Cathepsin K in Human samples. It is validated for Western Blot.Specifications
| Cathepsin K | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| NP_000387 | |
| 1513 | |
| Synthetic peptide directed towards the middle region of human CTSK. Peptide sequence SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD | |
| CTSK | |
| IgG | |
| Affinity Purified | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title