Novus Biologicals™ Dopamine beta-Hydroxylase Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP257836PEP

Catalog No. NBP257836PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dopamine beta-Hydroxylase. Source: E.coli Amino Acid Sequence: LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ The Dopamine beta-Hydroxylase Recombinant Protein Antigen is derived from E. coli. The Dopamine beta-Hydroxylase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 1621
• Common Name: Dopamine beta-Hydroxylase Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4
• Gene Alias: DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: DBH
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: Human

For research use only.