Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human Adenosine Deaminase Control Fragment Recombinant Protein
SDP

Catalog No. RP95404
Encompass
Click to view available options
:
100 μL, Unconjugated

Recombinant Protein

Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. May act as a positive regulator of T-cell coactivation.

Specifications

Accession Number P00813
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 100
Name ADA
Quantity 100 μL
Storage Requirements -20° C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene Symbol ADA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Sequence QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC
Expression System E. coli
Form Liquid
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.