Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90685

Invitrogen™ Human Calcium Channel beta-4 (aa 389-495) Control Fragment Recombinant Protein
SDP

Catalog No. RP90685
Encompass
Click to view available options
:
100 μL, Unconjugated

Description

Recombinant Protein

This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy and juvenile myoclonic epilepsy. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number O00305
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 785
Name Calcium Channel beta-4
Quantity 100 μL
Storage Requirements -20° C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 3110038O15Rik; CAB4; Cacnb4; CACNLB4; calcium channel beta 4 subunit; calcium channel voltage-dependent subunit beta 4; calcium channel, voltage-dependent, beta 4 subunit; calcium voltage-gated channel auxiliary subunit beta 4; Cchb4; dihydropyridine-sensitive L-type, calcium channel beta-4 subunit; EA5; EIG9; EJM; EJM4; EJM6; lh; OTTHUMP00000207247; OTTHUMP00000207249; Voltage-dependent L-type calcium channel subunit beta-4
Gene Symbol Cacnb4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Sequence EHLGEYLEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYPDS
Expression System E. coli
Form Liquid
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.