Invitrogen™ Human CALY (aa 1-89) Control Fragment Recombinant Protein

Description

Recombinant Protein

Calcyon is a single transmembrane protein that interacts with D1 dopamine receptors. Dopamine is a neurotransmitter that regulates synaptic transmission involved in learning and memory. D1 receptors, the most abundant dopamine receptor in the central nervous system, appear to modulate the activity of D2 dopamine receptors, mediate various behavioural responses, and regulate neuron growth and differentiation. Calcyon is present in neuronal cell bodies and processes of the cortex and hippocampus, and it is especially abundant in pyramidal neurons. Interaction of Calcyon with D1 receptors results in a release of intracellular calcium.

Specifications

• Accession Number: Q9NYX4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50632
• Name: CALY
• Quantity: 100 μL
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0710001P07Rik; 1110004A22Rik; Calcyon; calcyon D1 dopamine receptor-interacting protein (CALCYON); calcyon neuron specific vesicular protein; calcyon neuron-specific vesicular protein; calcyon protein; calcyon; D1 dopamine receptor-interacting protein; CALY; D1 dopamine receptor-interacting protein; dopamine receptor D1 interacting protein; Drd1ip; Neuron-specific vesicular protein calcyon; NSG3
• Gene Symbol: CALY
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Sequence: MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMI
• Expression System: E. coli
• Form: Liquid