Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human Dopamine beta Hydroxylase (aa 136-257) Control Fragment Recombinant Protein
SDP

Catalog No. RP100516
Encompass
Click to view available options
:
100 μL, Unconjugated

Recombinant Protein

The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide.

Specifications

Accession Number P09172
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1621
Name Dopamine beta Hydroxylase
Quantity 100 μL
Storage Requirements -20° C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase
Gene Symbol DBH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Sequence VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN
Expression System E. coli
Form Liquid
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.