Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human Dopamine Transporter (aa 164-234) Control Fragment Recombinant Protein
SDP

Catalog No. RP90672
Encompass
Click to view available options
:
100 μL, Unconjugated

Recombinant Protein

The Dopamine Transporter (DAT) is responsible for the reaccumulation of dopamine after it has been released. DAT antibodies and antibodies for other markers of catecholamine biosynthesis are widely used as markers for dopaminergic and noradrenergic neurons in a variety of applications including depression, schizophrenia, Parkinson's disease and drug abuse.

Specifications

Accession Number Q01959
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6531
Name Dopamine Transporter
Quantity 100 μL
Storage Requirements -20° C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Symbol Slc6a3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Sequence LHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLG
Expression System E. coli
Form Liquid
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.