Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human DRD1 (aa 337-445) Control Fragment Recombinant Protein
SDP

Catalog No. RP108736
Encompass
Click to view available options
:
100 μL, Unconjugated

Recombinant Protein

The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene.

Specifications

Accession Number P21728
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1812
Name DRD1
Quantity 100 μL
Storage Requirements -20° C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias C030036C15Rik; D(1A) dopamine receptor; D1 receptor; D1a; D1A dopamine receptor; D1a receptor; DADR; Dopamine 1 receptor; Dopamine D1 receptor; dopamine receptor D1; dopamine receptor D1A; Dopamine-1A receptor; Drd1; Drd-1; Drd1a; G protein-coupled receptor DRD1; Gpcr15
Gene Symbol DRD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Sequence FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP
Expression System E. coli
Form Liquid
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.