Invitrogen™ Human KCNK7 (aa 33-92) Control Fragment Recombinant Protein

Description

Recombinant Protein

This gene encodes a member of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel; however, it may require other non-pore-forming proteins for activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: Q9Y2U2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10089
• Name: KCNK7
• Quantity: 100 μL
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: K2p7.1; KCNK7; Potassium channel subfamily K member 7; potassium channel, subfamily K, member 7; potassium channel, two pore domain subfamily K, member 7; potassium two pore domain channel subfamily K member 7; RGD1565025; TWIK3; two pore domain K+ channel
• Gene Symbol: KCNK7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Sequence: GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL
• Expression System: E. coli
• Form: Liquid