Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109022

Invitrogen™ Human KCTD1 Control Fragment Recombinant Protein
SDP

Catalog No. RP109022
Encompass
Click to view available options
:
100 μL, Unconjugated

Description

Recombinant Protein

May repress the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C to various extent.

Specifications

Accession Number Q719H9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 284252
Name KCTD1
Quantity 100 μL
Storage Requirements -20° C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias BTB/POZ domain-containing protein KCTD1; C18orf5; KCTD1; potassium channel tetramerisation domain containing 1; potassium channel tetramerization domain containing 1; potassium channel tetramerization domain-containing protein 1; SENS
Gene Symbol KCTD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Sequence LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
Expression System E. coli
Form Liquid
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.