Invitrogen™ Human KCTD15 (aa 1-45) Control Fragment Recombinant Protein

Description

Recombinant Protein

Childhood and adult obesity in the United States and to a lesser extent the rest of the world has increased dramatically over the past decade. Both environmental and genetic factors are involved in the onset and progression of weight gain. Recently, the potassium channel KCTD15 was identified as a genetic loci associated with higher than normal body mass index (BMI) in humans along with genes such as GNPDA2, MTCH2, FTO, and TMEM18. Further studies on single nucleotide polymorphisms (SNPs) in non-diabetic and diabetic patients showed that FTO was most strongly associated with obesity while MTCH2 and GNPDA2 were still significantly associated with higher than normal BMI levels. At least two isoforms of KCTD15 are known to exist.

Specifications

• Accession Number: Q96SI1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79047
• Name: KCTD15
• Quantity: 100 μL
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC031749; BTB/POZ domain-containing protein KCTD15; Kctd15; potassium channel tetramerisation domain containing 15; potassium channel tetramerization domain containing 15; potassium channel tetramerization domain-containing protein 15
• Gene Symbol: KCTD15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI
• Expression System: E. coli
• Form: Liquid