Hydrogen Potassium ATPase Beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP16002820UL

Catalog No. NBP16002820

Description

Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Hydrogen Potassium ATPase Beta
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Format: Affinity Purified
• Gene Symbols: ATP4B
• Immunogen: Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK.
• Molecular Weight of Antigen: 33 kDa
• Quantity: 20ul
• Storage Requirements: Store at -20C. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: This product is specific to Subunit or Isoform: beta.

• Applications: Western Blot
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: P51164
• Gene Alias: ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
• Host Species: Rabbit
• Isotype: IgG
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 496
• Target Species: Human