Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Sodium Calcium Exchanger 1/NCX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25648325UL
Description
Sodium Calcium Exchanger 1/NCX1 Polyclonal specifically detects Sodium Calcium Exchanger 1/NCX1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Sodium Calcium Exchanger 1/NCX1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
FLJ37694, FLJ43417, Na(+)/Ca(2+)-exchange protein 1, sodium/calcium exchanger 1, solute carrier family 8 (sodium/calcium exchanger), member 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
6546 | |
Human | |
Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SLC8A1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
For Research Use Only
Spot an opportunity for improvement?