Sodium-Calcium Exchanger Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169515

Catalog No. NBP169515

Description

Sodium-Calcium Exchanger Polyclonal specifically detects Sodium-Calcium Exchanger in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Sodium-Calcium Exchanger
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Na(+)/Ca(2+)-exchange protein 3, Na+/Ca2+ exchanger 3, NCX3sodium/calcium exchanger SLC8A3, sodium/calcium exchanger 3, solute carrier family 8 (sodium/calcium exchanger), member 3, solute carrier family 8 (sodium-calcium exchanger), member 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 103 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96QG2
• Gene Symbols: SLC8A3
• Immunogen: Synthetic peptides corresponding to SLC8A3(solute carrier family 8 (sodium-calcium exchanger), member 3) The peptide sequence was selected from the N terminal of Sodium-Calcium Exchanger. Peptide sequence SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6547
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only