Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP258443PE

Novus Biologicals™ Adenosine A1R Recombinant Protein Antigen
SDP

Catalog No. NBP258443PE Shop All Novus Biologicals Products
Click to view available options
:
Quantity: 100μL

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Adenosine A1 R. Source: E.coli Amino Acid Sequence: NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN The Adenosine A1R Recombinant Protein Antigen is derived from E. coli. The Adenosine A1R Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

For Use With (Application) Blocking/Neutralizing, Control
Formulation PBS and 1M Urea, pH 7.4.
Gene ID (Entrez) 134
Name Adenosine A1R
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Quantity 100μL
Source E.Coli
Storage Requirements Store at −20C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Gene Alias adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1
Gene Symbol ADORA1
Product Type Recombinant Protein Antigen
Conjugate Unlabeled
Cross Reactivity Human
Recombinant Yes
Show More Show Less

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.