Novus Biologicals

Narrow Results

Classification

Monoclonal (373,987)
Polyclonal (311,219)

Collagen I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 195 publications

Pricing & Availability

Novus Biologicals™ Recombinant Human Peroxiredoxin 3 Protein

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pricing & Availability

Novus Biologicals™ LPS from E. Coli, TLR4 ligand

Applications: Functional

Pricing & Availability

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Peptide Array
Form	Purified
Isotype	IgG2c κ
Research Discipline	Cancer
Concentration	0.2 mg/mL
Antigen	Kallikrein 5
Regulatory Status	RUO
Purification Method	Protein A or G purified
Dilution	Immunohistochemistry-Paraffin 1 to 2 μg/mL, Protein Array
Gene Alias	EC 3.4.21, EC 3.4.21.4, kallikrein 5, Kallikrein-like protein 2, kallikrein-related peptidase 5, KLKL2, KLK-L2EC 3.4.21.-, SCTEkallikrein-5, Stratum corneum tryptic enzyme
Gene ID (Entrez)	25818
Formulation	10 mM PBS with 0.05% BSA
Immunogen	Recombinant fragment of human Kallikrein 5 protein (around aa 36-177) (exact sequence is proprietary)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	KLK5/3841

Mouse IgG1 Isotype Control (MG1) [mFluor Violet 450 SE], Novus Biologicals™

Mouse Monoclonal Antibody

Pricing & Availability

Fibroblast Activation Protein alpha/FAP Antibody (sibrotuzumab) - Humanized, Novus Biologicals™

Human Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at -20°C in powder form. Store at -80°C once reconstituted.
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	Flow Cytometry,ELISA,Functional Assay
Form	Purified
Isotype	IgG1
Gene Accession No.	Q12884
Research Discipline	Cancer, Protein Phosphatase
Antigen	Fibroblast Activation Protein alpha/FAP
Regulatory Status	RUO
Purification Method	Protein A purified
Gene Alias	170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, seprase, vibronectin
Gene ID (Entrez)	2191
Formulation	Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Immunogen	FAP
Classification	Monoclonal
Reconstitution	Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Primary or Secondary	Primary
Clone	sibrotuzumab

Novus Biologicals™ Mouse HMGB1/HMG-1 ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Pricing & Availability

alpha-Synuclein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Pricing & Availability

Novus Biologicals™ Glucose Assay Kit (Colorimetric)

Assay Kit (Colorimetric)

Pricing & Availability

Novus Biologicals™ NF-L Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Pricing & Availability

Laminin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 72 publications

Pricing & Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Chinese Hamster,Invertebrate,Mammalia,Rabbit,Sheep
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG
Gene Accession No.	P19137
Research Discipline	Angiogenesis, Apoptosis, Cancer, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix, Neuroscience, Signal Transduction, Tumor Suppressors
Concentration	1 mg/ml
Antigen	Laminin
Gene Symbols	LAMA1
Regulatory Status	RUO
Purification Method	IgG purified
Dilution	Western Blot 1:100 - 1:5000, Flow Cytometry, Immunohistochemistry 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:500 - 1:2000, Immunohistochemistry-Frozen 1:500 - 1:2000, Immunohistochemistry Free-Floating 1:1000 - 1:5000
Molecular Weight of Antigen	337 kDa
Gene Alias	LAMA, Laminin A chain, laminin subunit alpha-1, laminin, alpha 1, Laminin-1 subunit alpha, Laminin-3 subunit alpha, PTBHS, S-LAM alpha, S-laminin subunit alpha
Gene ID (Entrez)	284217
Formulation	50% PBS, 50% Glycerol with 5mM Sodium Azide
Immunogen	Laminin Antibody was made to Laminin 111 isolated from mouse Engelbreth-Holm-Swarm (EHS) sarcoma cells. [UniProt# P19137]
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Laminin Antibody is pan-specific and reacts well with all Laminin isoforms tested: Laminin-1 (alpha-1, beta-1, and gamma-1) and Laminin-2 (alpha-2, beta-1, and gamma-1).

SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™

Rabbit Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA
Form	Purified
Isotype	IgG
Research Discipline	Biologically Active Proteins, Cancer, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Stem Cell Markers
Antigen	SCF/c-kit Ligand
Regulatory Status	RUO
Purification Method	Protein A purified
Dilution	ELISA 1:5000-1:10000, Sandwich ELISA Detection 1:1000-1:10000
Gene Alias	DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, KIT ligand, Kitl, KL-1, Mast cell growth factor, MGFSHEP7, SCFStem cell factor, SFc-Kit ligand, steel factor
Gene ID (Entrez)	4254
Formulation	0.2 um filtered solution in PBS
Immunogen	Recombinant Human SCF/c-kit Ligand protein
Classification	Monoclonal
Primary or Secondary	Primary
Clone	4

Novus Biologicals™ DAPI Solution

Applications: Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Free-Floating, Immunohistochemistry Whole-Mount, Immunofluorescence, Immunocytochemistry

Pricing & Availability

Recoverin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Form	Purified
Isotype	IgG
Research Discipline	Neuroscience, Vision
Antigen	Recoverin
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	cancer associated retinopathy antigen, Protein CAR, RCV1Cancer-associated retinopathy protein, recoverin
Gene ID (Entrez)	5957
Formulation	PBS (pH 7.3), 50% glycerol
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Recoverin (NP_002894.1).,, Sequence:, MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Classification	Polyclonal
Primary or Secondary	Primary

Novus Biologicals™ Sheep Progesterone ELISA Kit (Colorimetric)

Sheep Progesterone ELISA Kit (Colorimetric) employs competitive ELISA technique for detection of Sheep Progesterone

Pricing & Availability
Specifications

Target	Progesterone
Product Type	ELISA Kit (Colorimetric)
Sample Type	Plasma,Serum,Tissue Homogenates
Sample Volume	50 to 100 μL
Synonym	Pregn 4 ene 3 20 dione
Assay Sensitivity	0.2ng/mL
Assay Range	0.4ng/mL to 30ng/mL
Storage Requirements	Store at 4°C
Research Discipline	Signal Transduction
For Use With (Application)	ELISA

Prev
1
2
3
4
5
6
...
45,963
Next

Welcome to fishersci.com

Novus Biologicals

Filtered Search Results

Narrow Results

Collagen I Antibody, Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Peroxiredoxin 3 ProteinSmall and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ LPS from E. Coli, TLR4 ligandSmall and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Kallikrein 5 Mouse anti-Human, Clone: KLK5/3841, Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Mouse IgG1 Isotype Control (MG1) [mFluor Violet 450 SE], Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Fibroblast Activation Protein alpha/FAP Antibody (sibrotuzumab) - Humanized, Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Mouse HMGB1/HMG-1 ELISA Kit (Colorimetric)Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

alpha-Synuclein Antibody, Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Glucose Assay Kit (Colorimetric)Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ NF-L Recombinant Protein AntigenSmall and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Laminin Antibody, Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

SCF/c-kit Ligand Rabbit anti-Human, Clone: 4, Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ DAPI SolutionSmall and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Recoverin Antibody, Novus Biologicals™Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Sheep Progesterone ELISA Kit (Colorimetric)Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More