Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ Adenosine Deaminase 2/CECR1 Protein
SDP

Catalog No. NBP189238PE Shop All Novus Biologicals Products
Click to view available options
:
0.1mL

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CECR1. The Adenosine Deaminase 2/CECR1 Recombinant Protein Antigen is derived from E. coli. The Adenosine Deaminase 2/CECR1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89238. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Concentration 0.5mg/mL
For Use With (Application) Blocking/Neutralizing, Control
Formulation PBS and 1M Urea, pH 7.4.
Gene ID (Entrez) 51816
Molecular Weight (g/mol) 34kDa
Purification Method Chromatography
Purity >80%
Quantity 0.1mL
Source E.Coli
Immunogen TDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDK
Storage Requirements Store at -20°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Gene Symbol CECR1
Product Type Adenosine Deaminase 2/CECR1
Conjugate Unlabeled
Host Species Human
Recombinant Yes
Show More Show Less

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.