Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP187404PE

Novus Biologicals™ Adenosine Deaminase/ADA Recombinant Protein Antigen
SDP

Catalog No. NBP187404PE Shop All Novus Biologicals Products
Click to view available options
:
0.1mL

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADA. The Adenosine Deaminase/ADA Recombinant Protein Antigen is derived from E. coli. The Adenosine Deaminase/ADA Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87404. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Concentration 0.5mg/mL
For Use With (Application) Blocking/Neutralizing, Control
Formulation PBS and 1M Urea, pH 7.4.
Gene ID (Entrez) 100
Molecular Weight (g/mol) 33kDa
Purification Method Chromatography
Purity >80%
Quantity 0.1mL
Source E.Coli
Immunogen GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE
Storage Requirements Store at -20°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Gene Symbol ADA
Product Type Adenosine Deaminase/ADA
Conjugate Unlabeled
Host Species Human
Recombinant Yes
Show More Show Less

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.