Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158875

Catalog No. NBP158875

Description

Calcium Activated Nucleotidase 1/CANT1 Polyclonal specifically detects Calcium Activated Nucleotidase 1/CANT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Calcium Activated Nucleotidase 1/CANT1
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Format: Affinity Purified
• Gene Symbols: CANT1
• Immunogen: Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY.
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Storage Requirements: Store at -20C. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Xenopus: 92%; Canine: 92%; Rabbit: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish

• Applications: Western Blot
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WVQ1
• Gene Alias: Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 100 ul
• Research Discipline: Lipid and Metabolism
• Primary or Secondary: Primary
• Gene ID (Entrez): 124583
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.