Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$165.00 - $487.50
Specifications
| Antigen | Calcium Activated Nucleotidase 1/CANT1 |
|---|---|
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158875
|
Novus Biologicals
NBP158875 |
100 ul |
Each for $487.50
|
|
|||||
|
NBP15887520
|
Novus Biologicals
NBP15887520UL |
20 μL |
Each for $165.00
|
|
|||||
Description
Calcium Activated Nucleotidase 1/CANT1 Polyclonal specifically detects Calcium Activated Nucleotidase 1/CANT1 in Human samples. It is validated for Western Blot.Specifications
| Calcium Activated Nucleotidase 1/CANT1 | |
| Unconjugated | |
| RUO | |
| Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1 | |
| CANT1 | |
| IgG |
| Western Blot | |
| Rabbit | |
| Q8WVQ1 | |
| 124583 | |
| Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title