Calcium Activated Nucleotidase 1/CANT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15887520UL

Catalog No. NBP15887520

Description

Calcium Activated Nucleotidase 1/CANT1 Polyclonal specifically detects Calcium Activated Nucleotidase 1/CANT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Calcium Activated Nucleotidase 1/CANT1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q8WVQ1
• Gene Symbols: CANT1
• Immunogen: Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY.
• Quantity: 20 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 124583
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG