Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$165.00 - $487.50
Specifications
| Antigen | Calcium Activated Nucleotidase 1/CANT1 |
|---|---|
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158875
|
Novus Biologicals
NBP158875 |
100 ul |
Each for $487.50
|
|
|||||
|
NBP15887520
|
Novus Biologicals
NBP15887520UL |
20 μL |
Each for $165.00
|
|
|||||
Description
Calcium Activated Nucleotidase 1/CANT1 Polyclonal specifically detects Calcium Activated Nucleotidase 1/CANT1 in Human samples. It is validated for Western Blot.Specifications
| Calcium Activated Nucleotidase 1/CANT1 | |
| Unconjugated | |
| RUO | |
| Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1 | |
| CANT1 | |
| IgG |
| Western Blot | |
| Rabbit | |
| Q8WVQ1 | |
| 124583 | |
| Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY. | |
| Primary |
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.