Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP2927170.1ML

Catalog No. NB416586

Description

Dopamine Receptor D4 Polyclonal antibody specifically detects Dopamine Receptor D4 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Dopamine Receptor D4
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin
• Gene Alias: D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRD4 (NP_000788.2). AWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCS
• Quantity: 0.1 mL
• Research Discipline: GPCR, Neuroscience
• Gene ID (Entrez): 1815
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified