Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hydrogen Potassium ATPase Beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$206.00 - $487.50
Specifications
Antigen | Hydrogen Potassium ATPase Beta |
---|---|
Immunogen | Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. |
Host Species | Rabbit |
Primary or Secondary | Primary |
Monoclonal or Polyclonal | Polyclonal |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16002820
![]() |
Novus Biologicals
NBP16002820UL |
20ul |
Each for $206.00
|
|
|||||
NBP160028
![]() |
Novus Biologicals
NBP160028 |
100 μL |
Each for $487.50
|
|
|||||
Description
Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Human samples. It is validated for Western Blot.Specifications
Hydrogen Potassium ATPase Beta | |
Rabbit | |
Polyclonal | |
Unconjugated | |
496 | |
Affinity Purified | |
Western Blot | |
RUO |
Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. | |
Primary | |
IgG | |
ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Immunogen affinity purified | |
Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title