Hydrogen Potassium ATPase Beta Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191573

Catalog No. NBP191573

Description

Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Hydrogen Potassium ATPase Beta
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 496
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_036642
• Gene Symbols: ATP4B
• Immunogen: Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Bovine: 92%; Canine: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Xenopus: 85%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG