Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hydrogen Potassium ATPase Beta Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$165.00 - $487.50
Specifications
| Antigen | Hydrogen Potassium ATPase Beta |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP191573
|
Novus Biologicals
NBP191573 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP19157320
|
Novus Biologicals
NBP19157320UL |
20 μL |
Each for $165.00
|
|
|||||
Description
Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Rat samples. It is validated for Western Blot.Specifications
| Hydrogen Potassium ATPase Beta | |
| Polyclonal | |
| Rabbit | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain | |
| ATP4B | |
| IgG | |
| Affinity purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_036642 | |
| 496 | |
| Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL. | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title