All Primary Antibodies

All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (1)
- (34)
- (22)
- (51)
- (4)
- (13)
- (61)
- (8)
- (45)
- (13)
- (154)
- (37)
- (163)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (167)
- (1)
- (1)
- (1)
- (1)
- (1)
- (32)
- (168)
- (170)
- (6)
- (2)
- (7)
- (8)
- (8)
- (1)
Filtered Search Results

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Antigen | Hydrogen Potassium ATPase Beta |
---|---|
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 496 |
Immunogen | Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL. |
Classification | Polyclonal |
Isotype | IgG |
Gene Accession No. | NP_036642 |
Primary or Secondary | Primary |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Endocrinology, Signal Transduction |
Antigen | Hydrogen Potassium ATPase Beta |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500 - 1:2000, ELISA |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 62-291 of human Hydrogen Potassium ATPase Beta (NP_000696.1).,, Sequence:, LMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Molecular Weight of Antigen | 33 kDa |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Immunogen | Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | This product is specific to Subunit or Isoform: beta. |
Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P51164 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Hydrogen Potassium ATPase Beta Antibody (SR1980), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at -20° C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Endocrinology, Signal Transduction |
Antigen | Hydrogen Potassium ATPase Beta |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Formulation | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
Immunogen | A synthesized peptide derived from human Hydrogen Potassium ATPase Beta (Uniprot #: P51164) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | SR1980 |
Hydrogen Potassium ATPase Beta Antibody (2G11), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 5 publications
Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Ascites |
Isotype | IgG1 |
Antigen | Hydrogen Potassium ATPase Beta |
Gene Symbols | ATP4B |
Regulatory Status | RUO |
Purification Method | Unpurified |
Dilution | Western Blot 1:4000, Flow Cytometry 1:50, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10 - 1:500, Immunohistochemistry-Paraffin 1:2000, Immunohistochemistry-Frozen 1:2000, Dot Blot 1:100 - 1:2000, Chromatin Immunoprecipitation (ChIP) 1:10-1:500 |
Gene Alias | ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain |
Gene ID (Entrez) | 496 |
Immunogen | Purified 34 kDa core peptide from deglycosylated hog gastric microsomes. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Detects the beta-subunit of hydrogen/potassium ATPase. |
Clone | 2G11 |
Hydrogen Potassium ATPase Beta Antibody (2G11), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 5 publications
Hydrogen Potassium ATPase Beta Antibody [HRP], Novus Biologicals Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Hydrogen Potassium ATPase Beta Antibody [PE], Novus Biologicals Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Hydrogen Potassium ATPase Beta Antibody [PerCP], Novus Biologicals Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Hydrogen Potassium ATPase Beta Antibody [Allophycocyanin], Novus Biologicals Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Hydrogen Potassium ATPase Beta Antibody [Biotin], Novus Biologicals Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Hydrogen Potassium ATPase Beta Antibody [FITC], Novus Biologicals Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Hydrogen Potassium ATPase Beta Antibody [DyLight 594], Novus Biologicals Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody