Filtered Search Results
Search results for "adenosine"

Thermo Scientific Chemicals Adenosine, 99%
CAS: 58-61-7 Molecular Formula: C10H13N5O4 Molecular Weight (g/mol): 267.25 MDL Number: MFCD00005752 InChI Key: OIRDTQYFTABQOQ-KQYNXXCUSA-N Synonym: adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol PubChem CID: 60961 ChEBI: CHEBI:16335 IUPAC Name: (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol SMILES: NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1
PubChem CID | 60961 |
---|---|
CAS | 58-61-7 |
Molecular Weight (g/mol) | 267.25 |
ChEBI | CHEBI:16335 |
MDL Number | MFCD00005752 |
SMILES | NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1 |
Synonym | adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol |
IUPAC Name | (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol |
InChI Key | OIRDTQYFTABQOQ-KQYNXXCUSA-N |
Molecular Formula | C10H13N5O4 |
Thermo Scientific Chemicals Adenosine, 99+%
CAS: 58-61-7 Molecular Formula: C10H13N5O4 Molecular Weight (g/mol): 267.25 MDL Number: MFCD00005752 InChI Key: OIRDTQYFTABQOQ-KQYNXXCUSA-N Synonym: adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol PubChem CID: 60961 ChEBI: CHEBI:16335 IUPAC Name: (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol SMILES: NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1
PubChem CID | 60961 |
---|---|
CAS | 58-61-7 |
Molecular Weight (g/mol) | 267.25 |
ChEBI | CHEBI:16335 |
MDL Number | MFCD00005752 |
SMILES | NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1 |
Synonym | adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol |
IUPAC Name | (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol |
InChI Key | OIRDTQYFTABQOQ-KQYNXXCUSA-N |
Molecular Formula | C10H13N5O4 |
Invitrogen™ TNP-ATP (2'-(or-3')-O-(Trinitrophenyl) Adenosine 5'-Triphosphate, Trisodium Salt)
Structural probe


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Tocris Bioscience™ Adenosine
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Endogenous adenosine receptor agonist
Adenosine, MP Biomedicals™
CAS: 58-61-7 Molecular Formula: C10H13N5O4 Molecular Weight (g/mol): 267.25 MDL Number: MFCD00005752 InChI Key: OIRDTQYFTABQOQ-KQYNXXCUSA-N Synonym: adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol PubChem CID: 60961 ChEBI: CHEBI:16335 IUPAC Name: (2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol SMILES: NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1
PubChem CID | 60961 |
---|---|
CAS | 58-61-7 |
Molecular Weight (g/mol) | 267.25 |
ChEBI | CHEBI:16335 |
MDL Number | MFCD00005752 |
SMILES | NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1 |
Synonym | adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol |
IUPAC Name | (2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol |
InChI Key | OIRDTQYFTABQOQ-KQYNXXCUSA-N |
Molecular Formula | C10H13N5O4 |
Adenosine, Spectrum™ Chemical
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
CAS: 58-61-7
CAS | 58-61-7 |
---|
Invitrogen™ MANT-ATP (2'-(or-3')-O-(N-Methylanthraniloyl) Adenosine 5'-Triphosphate, Trisodium Salt)
Produces nucleotide analogs causing little perturbation of nucleotide-protein interactions


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Invitrogen™ MANT-ADP (2'-(or-3')-O-(N-Methylanthraniloyl) Adenosine 5'-Diphosphate, Disodium Salt)
Produces nucleotide analogs causing little perturbation of nucleotide-protein interactions


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Adenosine, MP Biomedicals
CAS: 58-61-7 Molecular Formula: C10H13N5O4 Molecular Weight (g/mol): 267.25 MDL Number: MFCD00005752 InChI Key: OIRDTQYFTABQOQ-KQYNXXCUSA-N Synonym: adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol PubChem CID: 60961 ChEBI: CHEBI:16335 IUPAC Name: (2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol SMILES: NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1
PubChem CID | 60961 |
---|---|
CAS | 58-61-7 |
Molecular Weight (g/mol) | 267.25 |
ChEBI | CHEBI:16335 |
MDL Number | MFCD00005752 |
SMILES | NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1 |
Synonym | adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol |
IUPAC Name | (2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol |
InChI Key | OIRDTQYFTABQOQ-KQYNXXCUSA-N |
Molecular Formula | C10H13N5O4 |
Adenosine 99.0+%, TCI America™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
CAS: 58-61-7 Molecular Formula: C10H13N5O4 Molecular Weight (g/mol): 267.25 MDL Number: MFCD00005752 InChI Key: OIRDTQYFTABQOQ-KQYNXXCUSA-N Synonym: adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol PubChem CID: 60961 ChEBI: CHEBI:16335 IUPAC Name: (2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol SMILES: NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1
PubChem CID | 60961 |
---|---|
CAS | 58-61-7 |
Molecular Weight (g/mol) | 267.25 |
ChEBI | CHEBI:16335 |
MDL Number | MFCD00005752 |
SMILES | NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1 |
Synonym | adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol |
IUPAC Name | (2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol |
InChI Key | OIRDTQYFTABQOQ-KQYNXXCUSA-N |
Molecular Formula | C10H13N5O4 |
ADENOSINE-5'-DIPHOSPHATE, MP Biomedicals
CAS: 58-64-0 Molecular Formula: C10H15N5O10P2 Molecular Weight (g/mol): 427.203 MDL Number: MFCD00066473 InChI Key: XTWYTFMLZFPYCI-KQYNXXCUSA-N Synonym: adenosine 5'-diphosphate,adenosine diphosphate,adp,adenosine-5'-diphosphate,adenosine pyrophosphate,adenosine 5'-trihydrogen diphosphate,adenosine-diphosphate,adenosine 5'-pyrophosphate,adp nucleotide,5'-adenylphosphoric acid PubChem CID: 6022 ChEBI: CHEBI:16761 IUPAC Name: [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphono hydrogen phosphate SMILES: C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)O)O)O
PubChem CID | 6022 |
---|---|
CAS | 58-64-0 |
Molecular Weight (g/mol) | 427.203 |
ChEBI | CHEBI:16761 |
MDL Number | MFCD00066473 |
SMILES | C1=NC2=C(C(=N1)N)N=CN2C3C(C(C(O3)COP(=O)(O)OP(=O)(O)O)O)O |
Synonym | adenosine 5'-diphosphate,adenosine diphosphate,adp,adenosine-5'-diphosphate,adenosine pyrophosphate,adenosine 5'-trihydrogen diphosphate,adenosine-diphosphate,adenosine 5'-pyrophosphate,adp nucleotide,5'-adenylphosphoric acid |
IUPAC Name | [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphono hydrogen phosphate |
InChI Key | XTWYTFMLZFPYCI-KQYNXXCUSA-N |
Molecular Formula | C10H15N5O10P2 |
Adenosine, 99.8%, MP Biomedicals™
CAS: 58-61-7 Molecular Formula: C10H13N5O4 Molecular Weight (g/mol): 267.25 MDL Number: MFCD00005752 InChI Key: OIRDTQYFTABQOQ-KQYNXXCUSA-N Synonym: adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol PubChem CID: 60961 ChEBI: CHEBI:16335 SMILES: NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1
PubChem CID | 60961 |
---|---|
CAS | 58-61-7 |
Molecular Weight (g/mol) | 267.25 |
ChEBI | CHEBI:16335 |
MDL Number | MFCD00005752 |
SMILES | NC1=C2N=CN([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)C2=NC=N1 |
Synonym | adenosine,adenocard,adenoscan,adenine riboside,adenosin,beta-d-adenosine,nucleocardyl,boniton,sandesin,myocol |
InChI Key | OIRDTQYFTABQOQ-KQYNXXCUSA-N |
Molecular Formula | C10H13N5O4 |
Adenosine A2aR Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Apoptosis, GPCR, Immunology, Innate Immunity |
Antigen | Adenosine A2aR |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Gene Alias | adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8 |
Gene ID (Entrez) | 135 |
Formulation | PBS (pH 7.2) and 40% Glycerol |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
Classification | Polyclonal |
Primary or Secondary | Primary |
Thermo Scientific Chemicals Adenosine-5'-diphosphate trilithium salt, 98%
CAS: 31008-64-7 Molecular Formula: C10H12Li3N5O10P2 Molecular Weight (g/mol): 445.00 MDL Number: MFCD00065469 InChI Key: LZGPPAHUZSOGHJ-DJXXCMMGNA-K Synonym: adenosine-5'-diphosphate trilithium salt,adenosine 5'-trihydrogen diphosphate , trilithium salt,adp-li3,trilithium 1+ adenosine 5'-diphosphate,adenosine 5'-diphosphate trilithium salt,adenosine 5'-diphosphate,trilithium salt,adenosine-5'-diphosphate, trilithium salt,trilithium 1+ ion adenosine 5'-diphosphate,adenosine 5'-diphosphoric acid trilithium salt,adenosine-5'-diphosphate,trilithium salt PubChem CID: 56841973 IUPAC Name: trilithium;[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-oxidophosphoryl] phosphate SMILES: [Li+].[Li+].[Li+].NC1=C2N=CN([C@@H]3O[C@H](COP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)[C@H]3O)C2=NC=N1
PubChem CID | 56841973 |
---|---|
CAS | 31008-64-7 |
Molecular Weight (g/mol) | 445.00 |
MDL Number | MFCD00065469 |
SMILES | [Li+].[Li+].[Li+].NC1=C2N=CN([C@@H]3O[C@H](COP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)[C@H]3O)C2=NC=N1 |
Synonym | adenosine-5'-diphosphate trilithium salt,adenosine 5'-trihydrogen diphosphate , trilithium salt,adp-li3,trilithium 1+ adenosine 5'-diphosphate,adenosine 5'-diphosphate trilithium salt,adenosine 5'-diphosphate,trilithium salt,adenosine-5'-diphosphate, trilithium salt,trilithium 1+ ion adenosine 5'-diphosphate,adenosine 5'-diphosphoric acid trilithium salt,adenosine-5'-diphosphate,trilithium salt |
IUPAC Name | trilithium;[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-oxidophosphoryl] phosphate |
InChI Key | LZGPPAHUZSOGHJ-DJXXCMMGNA-K |
Molecular Formula | C10H12Li3N5O10P2 |