Primary Antibodies

Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1
–
15
of
445
results
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Mouse |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry,Lateral Flow,SDS-Page |
Form | Liquid |
Isotype | IgG |
Concentration | 1.9 mg/mL |
Antigen | Copper |
Regulatory Status | RUO |
Purification Method | Protein G |
Gene Alias | Cu |
Product Type | Antibody |
Formulation | PBS with 0.09% sodium azide; pH 7.4 |
Immunogen | Conjugate of Cu hapten and KLH. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | B4 |
Content And Storage | -20°C or -80°C if preferred |
---|---|
Target Species | Mollusca |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Liquid |
Isotype | IgG |
Concentration | 4.355 mg/mL |
Antigen | Helix pomatia Copper-Metallothionein |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | Cu-MT |
Product Type | Antibody |
Formulation | PBS with 50% glycerol and 0.03% ProClin 300; pH 7.4 |
Immunogen | Recombinant Helix pomatia Copper-metallothionein protein (1-64aa). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C or -80°C if preferred |
---|---|
Target Species | Mollusca |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Liquid |
Isotype | IgG |
Concentration | 4.355 mg/mL |
Antigen | Helix pomatia Copper-Metallothionein |
Regulatory Status | RUO |
Purification Method | Protein G |
Gene Alias | Cu-MT |
Product Type | Antibody |
Formulation | PBS with 50% glycerol and 0.03% ProClin 300; pH 7.4 |
Immunogen | Recombinant Roman snail Copper-metallothionein protein (1-64aa). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Antigen | Cu/Zn-SOD |
---|---|
Regulatory Status | RUO |
Gene Symbols | SOD1 |
Purification Method | Affinity Purified |
Content And Storage | 2°C to 8°C for one year |
Host Species | Rabbit |
Applications | Immunohistochemistry,Western Blot |
Gene ID (Entrez) | NP_000445 |
Formulation | Purified rabbit polyclonal antibody in buffer containing 0.1M Tris-Glycine (pH 7.4), 150mM NaCl with 0.05% sodium azide. |
Immunogen | KLH-conjugated linear peptide corresponding to a C-terminal sequence of human Cu/Zn-SOD. |
Classification | Polyclonal |
Gene Accession No. | P00441 |
Primary or Secondary | Primary |
SOD1/Cu-Zn SOD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 9 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat,Bovine |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Gene Accession No. | P00441 |
Research Discipline | Cancer, Diabetes Research, Mitochondrial Fusion Proteins, Neuronal Cell Markers, Neuroscience, Tumor Suppressors |
Concentration | 1.0 mg/ml |
Antigen | SOD1/Cu-Zn SOD |
Gene Symbols | SOD1 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Western Blot 0.025 - 0.1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 5 μg/mL |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Gene ID (Entrez) | 6647 |
Formulation | PBS, 0.05% BSA with 0.05% Sodium Azide |
Immunogen | The superoxide dismutase enzyme from bovine erythrocytes (CAS # 9054-89-1) was used as the immunogen. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Western Blot,Immunohistochemistry,Immunocytochemistry,Immunohistochemistry (Paraffin),KnockDown |
Form | Purified |
Isotype | IgG |
Research Discipline | Cancer, Diabetes Research, Mitochondrial Fusion Proteins, Neuronal Cell Markers, Neuroscience, Tumor Suppressors |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Immunogen affinity purified |
Dilution | Western Blot 0.04-0.4 ug/mL, Simple Western 1:30, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Gene ID (Entrez) | 6647 |
Formulation | PBS (pH 7.2) and 40% Glycerol |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | FITC |
Target Species | Human |
Host Species | Rabbit |
Applications | Flow Cytometry |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | PBS |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala2-Gln154). |
Primary or Secondary | Primary |
Clone | 106 |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | APC |
Target Species | Human |
Host Species | Rabbit |
Applications | Flow Cytometry |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | PBS |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala2-Gln154). |
Primary or Secondary | Primary |
Clone | 106 |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | PE |
Target Species | Human |
Host Species | Rabbit |
Applications | Flow Cytometry |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | PBS |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala2-Gln154). |
Primary or Secondary | Primary |
Clone | 106 |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | Biotin |
Target Species | Human |
Host Species | Rabbit |
Applications | ELISA,Immunofluorescence |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | PBS |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala 2-Gln 154). |
Primary or Secondary | Primary |
Clone | 101 |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | PerCP |
Target Species | Human |
Host Species | Rabbit |
Applications | Flow Cytometry |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | PBS |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala2-Gln154). |
Primary or Secondary | Primary |
Clone | 106 |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | Biotin |
Target Species | Human |
Host Species | Rabbit |
Applications | Flow Cytometry |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | PBS |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala2-Gln154). |
Primary or Secondary | Primary |
Clone | 106 |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | HRP |
Target Species | Human |
Host Species | Rabbit |
Applications | ELISA |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | PBS |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala 2-Gln 154). |
Primary or Secondary | Primary |
Clone | 101 |
Content And Storage | Store at -20 to -70C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,ELISA |
Form | Purified |
Isotype | IgG |
Research Discipline | Biologically Active Proteins, Cancer, Diabetes Research, Mitochondrial Fusion Proteins, Neuronal Cell Markers, Neuroscience, Tumor Suppressors |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:5000, Flow Cytometry 1:20-1:200, ELISA |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Gene ID (Entrez) | 6647 |
Formulation | PBS, pH 7.4, 150mM NaCl and 50% glycerol |
Immunogen | A synthesized peptide derived from Human SOD1/Cu-Zn SOD [UniProt P00441] |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 3E5 |
Content And Storage | Store at 4°C in the dark. |
---|---|
Conjugate | DyLight 755 |
Target Species | Human |
Host Species | Rabbit |
Applications | ELISA,Immunofluorescence |
Form | Purified |
Isotype | IgG |
Antigen | SOD1/Cu-Zn SOD |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | ALS, ALS1, amyotrophic lateral sclerosis 1 (adult), Cu, Cu/Zn superoxide dismutase, EC 1.15.1.1, homodimer, hSod1, indophenoloxidase A, IPOA, SOD, SOD, soluble, superoxide dismutase [Cu-Zn], Superoxide dismutase 1, superoxide dismutase 1, soluble, Zn superoxide dismutase, EC 1.15.1.110superoxide dismutase, cystolic |
Formulation | 50 mM Sodium Borate |
Gene ID (Entrez) | 6647 |
Classification | Monoclonal |
Immunogen | This antibody was obtained from a rabbit immunized with purified, recombinant Human SOD1/Cu-Zn SOD (NP_000445.1; Ala 2-Gln 154). |
Primary or Secondary | Primary |
Clone | 101 |