Recombinant Proteins

Recombinant Proteins
- (3)
- (484)
- (8)
- (348)
- (360)
- (29)
- (7)
- (5)
- (26)
- (2)
- (42)
- (31)
- (36)
- (474)
- (399)
- (30)
- (1)
- (4)
- (1)
- (9)
- (402)
- (1)
Filtered Search Results

Novus Biologicals™ Calcium-binding-protein-P22 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Regulatory Status | RUO |
---|---|
Purification Method | Protein |
Purity or Quality Grade | >95% |
Conjugate | Unconjugated |
Common Name | Calcium-binding-protein-P22 |
Molecular Weight (g/mol) | 24.7kDa |
Gene ID (Entrez) | 11261 |
Formulation | In 20mM Tris-HCl Buffer (pH 7.5) containing 10% Glycerol |
Immunogen | MGSSHHHHHH SSGLVPRGSH MMGSRASTLL RDEELEEIKK ETGFSHSQIT RLYSRFTSLD KGENGTLSRE DFQRIPELAI NPLGDRIINA FFPEGEDQVN FRGFMRTLAH FRPIEDNEKS KDVNGPEPLN SRSNKLHFAF RLYDLDKDEK ISRDELLQVL RMMVGVNISD EQLGSIADRT IQEADQDGDS AISFTEFVKV LEKVDVEQKM SIRFLH |
Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
Concentration | 1.0mg/mL |
For Use With (Application) | ELISA,SDS-PAGE |
Source | Human |
Novus Biologicals™ S100 calcium binding protein A14 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Regulatory Status | RUO |
---|---|
Purification Method | SDS-PAGE |
Purity or Quality Grade | >95% |
Conjugate | Unconjugated |
Common Name | S100 calcium binding protein A14 |
Molecular Weight (g/mol) | 13.8kDa |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT. |
Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
Concentration | 1mg/mL |
For Use With (Application) | SDS-PAGE |
R&D Systems™ Recombinant Human Calcium-sensing R/CaSR Protein
R&D Systems™ Recombinant Human Calcium-sensing R/CaSR Protein CF is a plasma membrane G-protein-coupled receptor that senses changes in the extracellular concentration of calcium ions and plays a key role in maintaining calcium homeostasis.
Invitrogen™ Human Calcium Sensing Receptor Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Calcium Sensing Receptor Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human Calcium Sensing Receptor (aa 214-305) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Calcium Sensing Receptor (aa 214-305) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human Calcium Channel beta-4 (aa 389-495) Control Fragment Recombinant Protein
Recombinant Protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | EHLGEYLEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYPDS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Calcium Channel beta-4 (aa 389-495) Control Fragment |
Recombinant | Recombinant |
Thermo Scientific™ Human CAMK2D (CaMKII Delta), His Tag Recombinant Protein
Recombinant Protein


Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
---|---|
Conjugate | Unconjugated |
Form | Liquid |
Common Name | CaMKII delta |
Molecular Weight (g/mol) | 59.2 kDa |
KinaseFamily | CAMK2 Kinase Family |
Sequence | Full length |
Concentration | See Label |
Expression System | Insect cells |
For Use With (Application) | Kinase Assay |
Name | Human CAMK2D (CaMKII Delta), His Tag |
Accession Number | Q13557 |
Gene Alias | [d]-CaMKII; 2810011D23Rik; 8030469K03Rik; Ca++/calmodulin-dependent protein kinase 2 delta subunit; Ca++/calmodulin-dependent protein kinase II delta subunit; Ca++/calmodulin-dependent protein kinase II, delta subunit; calcium/calmodulin dependent protein kinase II delta; calcium/calmodulin-dependent protein kinase (CaM kinase) II delta; calcium/calmodulin-dependent protein kinase II delta; calcium/calmodulin-dependent protein kinase II, delta; calcium/calmodulin-dependent protein kinase type II delta chain; calcium/calmodulin-dependent protein kinase type II subunit delta; calmodulin-dependent protein kinase II-delta dash; CaM kinase II delta subunit; caM kinase II subunit delta; CAM2; CaMK II; CAMK1; Camk2; CAMK2B; Camk2d; CAMK2G; CAMKB; CAMKD; CAMKG; Camki; CaMK-II delta subunit; CaMK-II subunit delta; CaM-kinase II delta chain; Kiaa4163; RATCAMKI |
Gene ID (Entrez) | 817 |
Formulation | 50 mM tris HCl with 0.05% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
Protein Tag | His-tag |
Species | Human |
Recombinant | Recombinant |
MP Biomedicals™ Concanavalin A from Canavalia ensiformis seeds
Metalloprotein that requires transition metal ion, such as manganese and calcium ions for binding
Novus Biologicals™ Recombinant Human S100P Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Novus Biologicals™ Recombinant Human S100B Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
Purity or Quality Grade | >95%, by SDS-PAGE |
---|---|
Conjugate | Unconjugated |
Form | Purified |
Molecular Weight (g/mol) | MolecularWeight-theroretical: 10.6 kDa |
Gene Symbol | S100B |
Endotoxin Concentration | Less than 1.0 EU/μg of S100B as determined by LAL method. |
Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.) |
For Use With (Application) | Bioactivity |
Protein | S100B |
Gene Alias | beta (neural), NEF, S100, S100 beta, S100 calcium binding protein B, S100 calcium-binding protein B, S100 calcium-binding protein, beta (neural), S-100 calcium-binding protein, beta chain, 10 protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100beta |
Gene ID (Entrez) | 6285 |
Formulation | Lyophilized from a 0.2 mm filtered concentrated solution in PBS (pH 7.4). |
Research Category | Alzheimers Research, Apoptosis, Biologically Active Proteins, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Epigenetics, Hypoxia, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Peroxisome Markers, Signal Transduction, Stem Cells |
Reconstitution | Briefly centrifuge vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to 0.1-1.0 mg/mL Stock solutions should be apportioned into working aliquots and stored (at -20°C.) |
Species | Human |
Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse CD38 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.