accessibility menu, dialog, popup

UserName
Viewing profile as user:

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (1,359)
Secondary Antibodies (63)
Isotype Controls and Standards (25)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

adenosine

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (64)
  • (1)
  • (1)
  • (2)
  • (24)
  • (8)
  • (2)
  • (3)
  • (1)
  • (24)
  • (12)
  • (4)
  • (157)
  • (1)
  • (2)
  • (2)
  • (1)
  • (48)
  • (178)
  • (3)
  • (11)
  • (427)
  • (1)
  • (6)
  • (46)
  • (5)
  • (8)
  • (7)
  • (1)
  • (3)
  • (3)
  • (398)
  • (1)

special interests

  • (88)
  • (46)
  • (689)

Classification

  • (2)
  • (543)
  • (519)
  • (93)
  • (2)

Conjugate

  • (33)
  • (6)
  • (5)
  • (11)
  • (11)
  • (20)
  • (13)
Show all

Host Species

  • (1)
  • (11)
  • (8)
  • (403)
  • (638)
  • (93)
  • (5)

Quantity

  • (2)
  • (2)
  • (345)
  • (9)
  • (4)
  • (2)
  • (4)
Show all

Target Species

  • (1)
  • (1)
  • (37)
  • (47)
  • (2)
  • (6)
  • (28)
Show all

Applications

  • (5)
  • (1)
  • (67)
  • (176)
  • (579)
  • (5)
  • (21)
Show all

Isotype

  • (627)
  • (12)
  • (1)
  • (94)
  • (95)
  • (64)
  • (128)
Show all

Regulatory Status

  • (1)
  • (1,124)

Form

  • (656)
  • (34)
  • (384)
  • (1)
  • (2)
  • (15)

Research Discipline

  • (2)
1 – 15 of 1,322 results
1

Adenosine A2aR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Apoptosis, GPCR, Immunology, Innate Immunity
Antigen Adenosine A2aR
Regulatory Status RUO
Purification Method Protein A purified
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8
Gene ID (Entrez) 135
Formulation PBS (pH 7.2) and 40% Glycerol
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD
Classification Polyclonal
Primary or Secondary Primary
2

Adenosine A2aR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 1 publication

Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Concentration 0.69 mg/mL
Antigen Adenosine A2aR
Gene Symbols ADORA2A
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 1:1000, Simple Western 1:20, Flow Cytometry, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:20-1:200
Molecular Weight of Antigen 45 kDa
Gene Alias adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8
Gene ID (Entrez) 135
Formulation PBS, 1 mg/ml BSA with 0.05% Sodium Azide
Immunogen Synthetic peptide corresponding to residues E(373) S H G D M G L P D V E L L S H E L K(391) of canine A2aAR.
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Detects adenosine receptor A2a. This does not detect other AR subtypes.
3

Invitrogen™ Adenosine Deaminase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Gene Accession No. P00813
Isotype IgG
Concentration 0.1 mg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 100
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Recombinant protein corresponding to Human Adenosine Deaminase. Recombinant protein control fragment (Product #RP-95404).
Classification Polyclonal
Primary or Secondary Primary
4

Invitrogen™ Adenosine Kinase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Immunocytochemistry
Form Liquid
Gene Accession No. P55263, P55264, Q64640
Isotype IgG
Concentration 1 mg/mL
Antigen Adenosine Kinase
Gene Symbols ADK
Regulatory Status RUO
Purification Method Antigen Affinity Chromatography
Gene Alias 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14
Gene ADK
Product Type Antibody
Gene ID (Entrez) 11534, 132, 25368
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Recombinant full length Human Adenosine Kinase.
Classification Polyclonal
Primary or Secondary Primary
5

Invitrogen™ Adenosine Deaminase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. Q6DG22
Isotype IgG
Concentration 0.52 mg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Antigen Affinity Chromatography, Protein A
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 436919
Formulation PBS with 0.09% sodium azide; pH 7.4
Immunogen KLH conjugated synthetic peptide between 114-148 amino acids of DANRE ADA.
Classification Polyclonal
Primary or Secondary Primary
6

Invitrogen™ Adenosine Kinase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P55263, P55264, Q64640
Isotype IgG
Concentration 1 mg/mL
Antigen Adenosine Kinase
Gene Symbols ADK
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14
Gene ADK
Product Type Antibody
Gene ID (Entrez) 11534, 132, 25368
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Recombinant fusion protein of human ADK.
Classification Polyclonal
Primary or Secondary Primary
7

Invitrogen™ Adenosine Deaminase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P00813, P03958, Q920P6
Isotype IgG
Concentration 0.2 mg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 100, 11486, 24165
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Recombinant protein corresponding to Human Adenosine Deaminase. Recombinant protein control fragment (Product #RP-95405).
Classification Polyclonal
Primary or Secondary Primary
8

Invitrogen™ Adenosine Kinase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P55263, P55264, Q64640
Isotype IgG
Concentration 0.28 mg/mL
Antigen Adenosine Kinase
Gene Symbols ADK
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14
Gene ADK
Product Type Antibody
Gene ID (Entrez) 11534, 132, 25368
Formulation PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Recombinant fragment corresponding to a region within amino acids 146 and 362 of Human Adenosine kinase.
Classification Polyclonal
Primary or Secondary Primary
9

Invitrogen™ Adenosine Kinase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Liquid
Gene Accession No. P55263
Isotype IgG
Concentration 1 mg/mL
Antigen Adenosine Kinase
Gene Symbols ADK
Regulatory Status RUO
Purification Method Antigen affinity chromatography, Protein A
Gene Alias 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14
Gene ADK
Product Type Antibody
Gene ID (Entrez) 132
Formulation PBS with no preservative
Immunogen Recombinant Human ADK protein (Met1-His345).
Classification Polyclonal
Primary or Secondary Primary
10

Adenosine Deaminase/ADA Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Cancer, Endocrinology
Antigen Adenosine Deaminase/ADA
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000, Immunoprecipitation 1-5 μL/mg of lysate, Immunohistochemistry-Paraffin 1:500-1:3000
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene ID (Entrez) 100
Formulation PBS (pH 7.0)
Immunogen Produced in rabbits immunized with a synthetic peptide corresponding to the C-terminus of the Human Adenosine Deaminase/ADA.
Classification Polyclonal
Primary or Secondary Primary
11

Adenosine A1R Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Research Discipline Apoptosis, GPCR, Growth and Development, Immunology, Innate Immunity, Neuronal Cell Markers, Signal Transduction, Vision
Antigen Adenosine A1R
Gene Symbols ADORA1
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1
Gene ID (Entrez) 134
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
12

Invitrogen™ Adenosine Deaminase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage -20°C
Target Species Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. P03958, Q920P6
Isotype IgG
Concentration 500 μg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 11486, 24165
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen E. coli-derived rat ADA recombinant protein (Position: A2-H241).
Classification Polyclonal
Primary or Secondary Primary
13

Invitrogen™ Adenosine Deaminase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Liquid
Gene Accession No. P00813
Isotype IgG
Concentration 1 mg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Antigen affinity chromatography, Protein A
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 100
Formulation PBS with 0.03% ProClin 300; pH 7
Immunogen A synthetic peptide corresponding to the C-terminus of the Human Adenosine Deaminase/ADA.
Classification Polyclonal
Primary or Secondary Primary
14

Invitrogen™ Adenosine Kinase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P55263
Isotype IgG
Concentration 1 mg/mL
Antigen Adenosine Kinase
Gene Symbols ADK
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14
Gene ADK
Product Type Antibody
Gene ID (Entrez) 132
Formulation PBS with 1% BSA, 20% glycerol and 0.01% thimerosal; pH 7
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 185 of Human Adenosine kinase.
Classification Polyclonal
Primary or Secondary Primary
15

Invitrogen™ Adenosine Deaminase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. P00813
Isotype IgG
Concentration 1 mg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 100
Formulation PBS with 20% glycerol and 0.01% thimerosal; pH 7
Immunogen Recombinant fragment contains a sequence corresponding to a region within amino acids 119 and 363 of Adenosine Deaminase.
Classification Polyclonal
Primary or Secondary Primary