
Antibodies
Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1
–
15
of
867
results
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse,Rat,Bovine |
Host Species | Sheep |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P09172, P15101, Q05754, Q64237 |
Isotype | IgG |
Concentration | Conc. Not Determined |
Antigen | Dopamine beta Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Gene Alias | Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase |
Gene | DBH |
Product Type | Antibody |
Gene ID (Entrez) | 13166, 1621, 25699, 280758 |
Formulation | Whole serum with 0.05% sodium azide |
Immunogen | Synthetic peptide corresponding to residues S(43) E P P E S P F P Y H I P L D P E G T L(62) of rat DBH. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P09172 |
Isotype | IgG |
Concentration | 0.04 mg/mL |
Antigen | Dopamine beta Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase |
Gene | DBH |
Product Type | Antibody |
Gene ID (Entrez) | 1621 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant Protein corresonding to Human Dopamine beta Hydroxylase. Recombinant protein control fragment (Product #RP-105510). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine D3R/DRD3 Antibody (SR1747), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at -20° C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR |
Antigen | Dopamine D3R/DRD3 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | D(3) dopamine receptor, D3DR, Dopamine D3 receptor, dopamine receptor D3, essential tremor 1, ETM1, FET1, MGC149204, MGC149205 |
Gene ID (Entrez) | 1814 |
Formulation | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
Immunogen | A synthesized peptide derived from human Dopamine D3R/DRD3 (Uniprot #: P35462) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | SR1747 |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Mouse,Rat,Zebrafish |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P23977, Q61327 |
Isotype | IgG |
Concentration | 1.93 mg/mL |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 13162, 24898, 80787 |
Formulation | PBS with 20% glycerol and 0.025% ProClin 300; pH 7 |
Immunogen | Recombinant protein encompassing a sequence within the C-terminus region of Mouse Dopamine Transporter. The exact sequence is proprietary. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P23977, Q01959, Q61327 |
Isotype | IgG |
Concentration | 0.84 mg/mL |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Affinity Chromatography |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 13162, 24898, 6531 |
Formulation | PBS with 50% glycerol and 0.05% ProClin 300; pH 7.3 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Transporter/SLC6A3 (NP_0010351). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Liquid |
Gene Accession No. | Q01959 |
Isotype | IgG |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 6531 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant Protein corresonding to Human Dopamine Transporter. Recombinant protein control fragment (Product #RP-108307). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Monkey |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Frozen),Western Blot |
Form | Liquid |
Gene Accession No. | Q01959 |
Isotype | IgG |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Affinity Chromatography |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 6531 |
Formulation | 0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and no preservative; pH 7.5 |
Immunogen | Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region of human SLC6A3 conjugated to KLH. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Mouse,Rat,Monkey |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Western Blot |
Form | Liquid |
Gene Accession No. | P23977, Q01959, Q61327 |
Isotype | IgG |
Concentration | 0.30 mg/mL |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Affinity chromatography |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 13162, 24898, 6531 |
Formulation | 0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and no preservative; pH 7.5 |
Immunogen | Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region of human SLC6A3 conjugated to KLH. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P23977, Q01959, Q61327 |
Isotype | IgG |
Concentration | 1 mg/mL |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Affinity Chromatography |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 13162, 24898, 6531 |
Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.4 |
Immunogen | A synthesized peptide derived from human SLC6A3(Accession Q01959), corresponding to amino acid residues G481-F531. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine beta-Hydroxylase Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Cancer, Lipid and Metabolism, Neuroscience |
Antigen | Dopamine beta-Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1 |
Gene ID (Entrez) | 1621 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Monkey |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Frozen),Western Blot |
Form | Liquid |
Gene Accession No. | Q01959, Q61327 |
Isotype | IgG |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Affinity chromatography |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 13162, 6531 |
Formulation | 0.01M HEPES with 0.01% BSA, 50% glycerol, 0.15M NaCl and 0.09% sodium azide; pH 7.5 |
Immunogen | Synthetic peptide corresponding to the c-terminus region of human dopamine transporter conjugated to KLH. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Liquid |
Gene Accession No. | Q01959 |
Isotype | IgG |
Concentration | 0.5 mg/mL |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Ammonium Sulfate Precipitation |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 6531 |
Formulation | TBS with 0.5% BSA and 0.02% sodium azide; pH 7.3 |
Immunogen | Peptide with sequence C-QLTSSTLTNPRQSP (aa 41-54). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Neuroscience |
Antigen | Dopamine Receptor D4 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
Gene Alias | D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor |
Gene ID (Entrez) | 1815 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRD4 (NP_000788.2). AWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCS |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Neuroscience |
Antigen | Dopamine Receptor D4 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:1000 |
Gene Alias | D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor |
Gene ID (Entrez) | 1815 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D4 (P21917). MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGA |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Liquid |
Gene Accession No. | P23977, Q01959, Q61327 |
Isotype | IgG1 |
Concentration | 1 mg/mL |
Antigen | Dopamine Transporter |
Gene Symbols | Slc6a3 |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3 |
Gene | Slc6a3 |
Product Type | Antibody |
Gene ID (Entrez) | 13162, 24898, 6531 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant Protein corresonding to Human Dopamine Transporter. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | CL3123 |