accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,211)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

adenosine

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (1)
  • (1)
  • (1)
  • (2)
  • (1)
  • (8)
  • (3)
  • (3)
  • (1)
  • (24)
  • (1)
  • (11)
  • (4)
  • (1)
  • (2)
  • (2)
  • (1)
  • (416)
  • (11)
  • (473)
  • (1)
  • (6)
  • (3)
  • (54)
  • (3)
  • (8)
  • (8)
  • (1)
  • (3)
  • (3)
  • (408)
  • (1)
  • (14)
  • (1)

special interests

  • (118)
  • (50)
  • (515)

Classification

  • (2)
  • (565)
  • (566)
  • (30)
  • (2)

Conjugate

  • (27)
  • (6)
  • (5)
  • (14)
  • (14)
  • (21)
  • (15)
Show all

Host Species

  • (10)
  • (8)
  • (407)
  • (648)
  • (89)
  • (3)

Quantity

  • (2)
  • (2)
  • (391)
  • (9)
  • (4)
  • (2)
  • (5)
Show all

Target Species

  • (1)
  • (38)
  • (46)
  • (2)
  • (7)
  • (28)
  • (2)
Show all

Applications

  • (5)
  • (1)
  • (67)
  • (163)
  • (585)
  • (5)
  • (20)
Show all

Isotype

  • (636)
  • (10)
  • (1)
  • (98)
  • (89)
  • (62)
  • (126)
Show all

Regulatory Status

  • (1)
  • (1,130)

Form

  • (614)
  • (28)
  • (438)
  • (1)
  • (2)
  • (15)

Research Discipline

  • (2)
1 – 15 of 1,122 results
1

Adenosine A2aR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Apoptosis, GPCR, Immunology, Innate Immunity
Antigen Adenosine A2aR
Regulatory Status RUO
Purification Method Protein A purified
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8
Gene ID (Entrez) 135
Formulation PBS (pH 7.2) and 40% Glycerol
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD
Classification Polyclonal
Primary or Secondary Primary
2

Adenosine A2aR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 1 publication

Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Concentration 0.69 mg/mL
Antigen Adenosine A2aR
Gene Symbols ADORA2A
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 1:1000, Simple Western 1:20, Flow Cytometry, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:20-1:200
Molecular Weight of Antigen 45 kDa
Gene Alias adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8
Gene ID (Entrez) 135
Formulation PBS, 1 mg/ml BSA with 0.05% Sodium Azide
Immunogen Synthetic peptide corresponding to residues E(373) S H G D M G L P D V E L L S H E L K(391) of canine A2aAR.
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Detects adenosine receptor A2a. This does not detect other AR subtypes.
3

Adenosine A1R Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Research Discipline Apoptosis, GPCR, Growth and Development, Immunology, Innate Immunity, Neuronal Cell Markers, Signal Transduction, Vision
Antigen Adenosine A1R
Gene Symbols ADORA1
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1
Gene ID (Entrez) 134
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
4

Adenosine Deaminase/ADA Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Cancer, Endocrinology
Antigen Adenosine Deaminase/ADA
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000, Immunoprecipitation 1-5 μL/mg of lysate, Immunohistochemistry-Paraffin 1:500-1:3000
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene ID (Entrez) 100
Formulation PBS (pH 7.0)
Immunogen Produced in rabbits immunized with a synthetic peptide corresponding to the C-terminus of the Human Adenosine Deaminase/ADA.
Classification Polyclonal
Primary or Secondary Primary
5

Adenosine A1R Antibody (SR1610), Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at -20° C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,Immunohistochemistry,Immunofluorescence,Immunoprecipitation
Form Purified
Isotype IgG
Research Discipline Apoptosis, GPCR, Growth and Development, Immunology, Innate Immunity, Neuronal Cell Markers, Signal Transduction, Vision
Antigen Adenosine A1R
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000, Flow Cytometry 1:100, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1:50-1:200, Immunoprecipitation 1:50
Gene Alias adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1
Gene ID (Entrez) 134
Formulation PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Immunogen A synthesized peptide derived from human Adenosine A1R (Uniprot #: P30542)
Classification Monoclonal
Primary or Secondary Primary
Clone SR1610
6

Adenosine Deaminase/ADA Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen Adenosine Deaminase/ADA
Gene Symbols ADA
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene ID (Entrez) 100
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
7

Adenosine Deaminase/ADA Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunofluorescence,Immunoprecipitation
Form Purified
Isotype IgG
Research Discipline Cancer, Endocrinology
Antigen Adenosine Deaminase/ADA
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:300-1:10000, Immunoprecipitation 0.5-2 μL/mg of lysate
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene ID (Entrez) 100
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with a synthetic peptide corresponding to the C-terminus of the Human Adenosine Deaminase/ADA.
Classification Polyclonal
Primary or Secondary Primary
8

Adenosine Deaminase/ADA Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,ELISA,Immunoprecipitation
Form Purified
Isotype IgG
Research Discipline Cancer, Endocrinology
Antigen Adenosine Deaminase/ADA
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000, ELISA 1:5000-1:10000, Immunoprecipitation 1-4 uL/mg of lysate
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene ID (Entrez) 100
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Human Adenosine Deaminase/ADA (Uniprot#: P00813; Met1-Leu363).
Classification Polyclonal
Primary or Secondary Primary
9

Adenosine Deaminase/ADA Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 2 publications

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin),KnockDown
Isotype IgG
Gene Accession No. P00813
Antigen Adenosine Deaminase/ADA
Gene Symbols ADA
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.04 - 0.4 ug/ml, Flow Cytometry Reported in the scientific literature (PMID: 25172498)., Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated Reported in the scientific literature (PMID: 31978345).
Molecular Weight of Antigen 41 kDa
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene ID (Entrez) 100
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of human Adenosine Deaminase/ADA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
10

Adenosine Deaminase/ADA Antibody (SR1685), Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at -20° C. Avoid freeze/thaw cycles.
Target Species Human,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunofluorescence,Immunoprecipitation
Form Purified
Isotype IgG
Research Discipline Cancer, Endocrinology
Antigen Adenosine Deaminase/ADA
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000, Immunocytochemistry/Immunofluorescence 1:50-1:200, Immunoprecipitation 1:50
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene ID (Entrez) 100
Formulation PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Immunogen A synthesized peptide derived from human Adenosine Deaminase/ADA (Uniprot #: P00813)
Classification Monoclonal
Primary or Secondary Primary
Clone SR1685
11

Adenosine A1R Antibody - BSA Free, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 6 publications

Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. P25099
Concentration 1 mg/mL
Antigen Adenosine A1R
Gene Symbols ADORA1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 1:500, Flow Cytometry 3 - 5 μg/ 106 cells, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunohistochemistry-Frozen
Molecular Weight of Antigen 37 kDa
Gene Alias adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1
Gene ID (Entrez) 134
Formulation PBS and 1 mg/ml BSA with 0.05% Sodium Azide
Immunogen Synthetic peptide corresponding to residues C(309) Q P K P P I D E D L P E E K A E D(326) of rat Adenosine Receptor A1.
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Detects Adenosine Receptor A1. This does not detect other AR subtypes.
12

Adenosine Deaminase 2/CECR1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Signal Transduction
Antigen Adenosine Deaminase 2/CECR1
Gene Symbols CECR1
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias ADA2, adenosine deaminase CECR1, ADGFadenosine deaminase 2, cat eye syndrome chromosome region, candidate 1, Cat eye syndrome critical region protein 1, CECR2, EC 3.5.4.4, IDGFL
Gene ID (Entrez) 51816
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDK
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
13

Adenosine Deaminase Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P00813
Concentration 0.1 mg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 100
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Classification Polyclonal
Primary or Secondary Primary
14

Adenosine Kinase Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Paraffin)
Form Liquid
Isotype IgG
Gene Accession No. P55263, P55264, Q64640
Concentration 1 mg/mL
Antigen Adenosine Kinase
Gene Symbols ADK
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14
Gene ADK
Product Type Antibody
Gene ID (Entrez) 11534, 132, 25368
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.2
Classification Polyclonal
Primary or Secondary Primary
15

Adenosine Deaminase Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Isotype IgG
Gene Accession No. Q6DG22
Concentration 0.52 mg/mL
Antigen Adenosine Deaminase
Gene Symbols ADA
Regulatory Status RUO
Purification Method Protein A
Gene Alias ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Gene ADA
Product Type Antibody
Gene ID (Entrez) 436919
Formulation PBS with 0.09% sodium azide
Classification Polyclonal
Primary or Secondary Primary