
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (2)
- (543)
- (519)
- (93)
- (2)
- (33)
- (6)
- (5)
- (11)
- (11)
- (20)
- (13)
- (4)
- (11)
- (12)
- (3)
- (15)
- (11)
- (30)
- (1)
- (2)
- (2)
- (2)
- (4)
- (4)
- (4)
- (2)
- (2)
- (4)
- (2)
- (14)
- (11)
- (11)
- (11)
- (12)
- (10)
- (12)
- (11)
- (11)
- (44)
- (2)
- (4)
- (15)
- (14)
- (10)
- (14)
- (14)
- (10)
- (14)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (44)
- (1)
- (2)
- (9)
- (14)
- (5)
- (6)
- (2)
- (17)
- (3)
- (4)
- (5)
- (3)
- (4)
- (5)
- (2)
- (519)
- (6)
- (1)
- (2)
- (11)
- (11)
- (11)
- (1)
- (11)
- (8)
- (403)
- (638)
- (93)
- (5)
- (2)
- (2)
- (345)
- (9)
- (4)
- (2)
- (4)
- (6)
- (3)
- (295)
- (187)
- (88)
- (6)
- (1)
- (1)
- (17)
- (3)
- (5)
- (23)
- (9)
- (36)
- (37)
- (4)
- (3)
- (12)
- (1)
- (2)
- (30)
- (1)
- (5)
- (15)
- (1)
- (1)
- (1)
- (37)
- (47)
- (2)
- (6)
- (28)
- (2)
- (2)
- (978)
- (1)
- (27)
- (390)
- (37)
- (2)
- (31)
- (246)
- (19)
- (2)
- (1)
- (4)
Filtered Search Results

Adenosine A2aR Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Apoptosis, GPCR, Immunology, Innate Immunity |
Antigen | Adenosine A2aR |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Gene Alias | adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8 |
Gene ID (Entrez) | 135 |
Formulation | PBS (pH 7.2) and 40% Glycerol |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
Classification | Polyclonal |
Primary or Secondary | Primary |
Adenosine A2aR Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 1 publication
Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Concentration | 0.69 mg/mL |
Antigen | Adenosine A2aR |
Gene Symbols | ADORA2A |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 1:1000, Simple Western 1:20, Flow Cytometry, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10 - 1:100, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:20-1:200 |
Molecular Weight of Antigen | 45 kDa |
Gene Alias | adenosine A2 receptor, adenosine A2a receptor, adenosine receptor A2a, adenosine receptor subtype A2a, ADORA 2, ADORA2, hA2aR, RDC8 |
Gene ID (Entrez) | 135 |
Formulation | PBS, 1 mg/ml BSA with 0.05% Sodium Azide |
Immunogen | Synthetic peptide corresponding to residues E(373) S H G D M G L P D V E L L S H E L K(391) of canine A2aAR. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Detects adenosine receptor A2a. This does not detect other AR subtypes. |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Gene Accession No. | P00813 |
Isotype | IgG |
Concentration | 0.1 mg/mL |
Antigen | Adenosine Deaminase |
Gene Symbols | ADA |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028 |
Gene | ADA |
Product Type | Antibody |
Gene ID (Entrez) | 100 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant protein corresponding to Human Adenosine Deaminase. Recombinant protein control fragment (Product #RP-95404). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P55263, P55264, Q64640 |
Isotype | IgG |
Concentration | 1 mg/mL |
Antigen | Adenosine Kinase |
Gene Symbols | ADK |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography |
Gene Alias | 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14 |
Gene | ADK |
Product Type | Antibody |
Gene ID (Entrez) | 11534, 132, 25368 |
Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant full length Human Adenosine Kinase. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Zebrafish |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Liquid |
Gene Accession No. | Q6DG22 |
Isotype | IgG |
Concentration | 0.52 mg/mL |
Antigen | Adenosine Deaminase |
Gene Symbols | ADA |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography, Protein A |
Gene Alias | ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028 |
Gene | ADA |
Product Type | Antibody |
Gene ID (Entrez) | 436919 |
Formulation | PBS with 0.09% sodium azide; pH 7.4 |
Immunogen | KLH conjugated synthetic peptide between 114-148 amino acids of DANRE ADA. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P55263, P55264, Q64640 |
Isotype | IgG |
Concentration | 1 mg/mL |
Antigen | Adenosine Kinase |
Gene Symbols | ADK |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14 |
Gene | ADK |
Product Type | Antibody |
Gene ID (Entrez) | 11534, 132, 25368 |
Formulation | PBS with 50% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant fusion protein of human ADK. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P00813, P03958, Q920P6 |
Isotype | IgG |
Concentration | 0.2 mg/mL |
Antigen | Adenosine Deaminase |
Gene Symbols | ADA |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028 |
Gene | ADA |
Product Type | Antibody |
Gene ID (Entrez) | 100, 11486, 24165 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant protein corresponding to Human Adenosine Deaminase. Recombinant protein control fragment (Product #RP-95405). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P55263, P55264, Q64640 |
Isotype | IgG |
Concentration | 0.28 mg/mL |
Antigen | Adenosine Kinase |
Gene Symbols | ADK |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14 |
Gene | ADK |
Product Type | Antibody |
Gene ID (Entrez) | 11534, 132, 25368 |
Formulation | PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7 |
Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 362 of Human Adenosine kinase. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Western Blot |
Form | Liquid |
Gene Accession No. | P55263 |
Isotype | IgG |
Concentration | 1 mg/mL |
Antigen | Adenosine Kinase |
Gene Symbols | ADK |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography, Protein A |
Gene Alias | 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14 |
Gene | ADK |
Product Type | Antibody |
Gene ID (Entrez) | 132 |
Formulation | PBS with no preservative |
Immunogen | Recombinant Human ADK protein (Met1-His345). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Adenosine Deaminase/ADA Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | Cancer, Endocrinology |
Antigen | Adenosine Deaminase/ADA |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000, Immunoprecipitation 1-5 μL/mg of lysate, Immunohistochemistry-Paraffin 1:500-1:3000 |
Gene Alias | ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4 |
Gene ID (Entrez) | 100 |
Formulation | PBS (pH 7.0) |
Immunogen | Produced in rabbits immunized with a synthetic peptide corresponding to the C-terminus of the Human Adenosine Deaminase/ADA. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Adenosine A1R Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Apoptosis, GPCR, Growth and Development, Immunology, Innate Immunity, Neuronal Cell Markers, Signal Transduction, Vision |
Antigen | Adenosine A1R |
Gene Symbols | ADORA1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1 |
Gene ID (Entrez) | 134 |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | -20°C |
---|---|
Target Species | Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry (Paraffin),Western Blot |
Form | Lyophilized |
Gene Accession No. | P03958, Q920P6 |
Isotype | IgG |
Concentration | 500 μg/mL |
Antigen | Adenosine Deaminase |
Gene Symbols | ADA |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028 |
Gene | ADA |
Product Type | Antibody |
Gene ID (Entrez) | 11486, 24165 |
Formulation | PBS with 4mg trehalose and 0.05mg sodium azide |
Immunogen | E. coli-derived rat ADA recombinant protein (Position: A2-H241). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
Form | Liquid |
Gene Accession No. | P00813 |
Isotype | IgG |
Concentration | 1 mg/mL |
Antigen | Adenosine Deaminase |
Gene Symbols | ADA |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography, Protein A |
Gene Alias | ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028 |
Gene | ADA |
Product Type | Antibody |
Gene ID (Entrez) | 100 |
Formulation | PBS with 0.03% ProClin 300; pH 7 |
Immunogen | A synthetic peptide corresponding to the C-terminus of the Human Adenosine Deaminase/ADA. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | P55263 |
Isotype | IgG |
Concentration | 1 mg/mL |
Antigen | Adenosine Kinase |
Gene Symbols | ADK |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | 2310026J05Rik; 5033405D03Rik; Adenosine 5'-phosphotransferase; adenosine kinase; ADK; AI255373; AI987814; AK; testicular tissue protein Li 14 |
Gene | ADK |
Product Type | Antibody |
Gene ID (Entrez) | 132 |
Formulation | PBS with 1% BSA, 20% glycerol and 0.01% thimerosal; pH 7 |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 185 of Human Adenosine kinase. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Liquid |
Gene Accession No. | P00813 |
Isotype | IgG |
Concentration | 1 mg/mL |
Antigen | Adenosine Deaminase |
Gene Symbols | ADA |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028 |
Gene | ADA |
Product Type | Antibody |
Gene ID (Entrez) | 100 |
Formulation | PBS with 20% glycerol and 0.01% thimerosal; pH 7 |
Immunogen | Recombinant fragment contains a sequence corresponding to a region within amino acids 119 and 363 of Adenosine Deaminase. |
Classification | Polyclonal |
Primary or Secondary | Primary |