All Primary Antibodies

All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (210)
- (277)
- (9)
- (1)
- (14)
- (1)
- (190)
- (275)
- (6)
- (11)
- (4)
- (2)
- (1)
- (128)
- (1)
- (2)
- (174)
- (76)
- (10)
- (1)
- (5)
- (9)
- (3)
- (13)
- (2)
- (2)
- (18)
- (1)
- (9)
- (9)
- (26)
- (1)
- (1)
- (2)
- (4)
- (5)
- (5)
- (4)
- (4)
- (5)
- (5)
- (4)
- (8)
- (5)
- (5)
- (5)
- (5)
- (5)
- (2)
- (5)
- (5)
- (5)
- (7)
- (7)
- (5)
- (2)
- (5)
- (5)
- (2)
- (5)
- (2)
- (2)
- (2)
- (2)
- (3)
- (346)
- (4)
- (4)
- (4)
- (1)
- (16)
- (25)
- (14)
- (25)
- (1)
- (4)
- (3)
- (1)
- (5)
- (378)
- (46)
- (7)
- (215)
- (13)
- (3)
- (7)
- (22)
- (4)
- (13)
- (21)
- (209)
- (8)
- (4)
- (1)
- (2)
- (2)
Filtered Search Results

Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Bovine,Human,Mouse,Rat |
Host Species | Sheep |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Frozen),Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P09172, P15101, Q05754, Q64237 |
Concentration | Conc. Not Determined |
Antigen | Dopamine beta Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Gene Alias | Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase |
Gene | DBH |
Product Type | Antibody |
Gene ID (Entrez) | 13166, 1621, 25699, 280758 |
Formulation | whole serum with 0.05% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine D3R/DRD3 Antibody (SR1747), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at -20° C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR |
Antigen | Dopamine D3R/DRD3 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | D(3) dopamine receptor, D3DR, Dopamine D3 receptor, dopamine receptor D3, essential tremor 1, ETM1, FET1, MGC149204, MGC149205 |
Gene ID (Entrez) | 1814 |
Formulation | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
Immunogen | A synthesized peptide derived from human Dopamine D3R/DRD3 (Uniprot #: P35462) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | SR1747 |
Dopamine beta-Hydroxylase Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Cancer, Lipid and Metabolism, Neuroscience |
Antigen | Dopamine beta-Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1 |
Gene ID (Entrez) | 1621 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Neuroscience |
Antigen | Dopamine Receptor D4 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
Gene Alias | D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor |
Gene ID (Entrez) | 1815 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRD4 (NP_000788.2). AWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCS |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Neuroscience |
Antigen | Dopamine Receptor D4 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:1000 |
Gene Alias | D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor |
Gene ID (Entrez) | 1815 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D4 (P21917). MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGA |
Classification | Polyclonal |
Primary or Secondary | Primary |
Antigen | Dopamine D2S Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic (PLKEAARRC) peptide corresponding to amino acids 239-246 of human D2s dopamine receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the ∽48kDa dopamine D25 receptor. Does not cross-react with other dopamine receptors. |
Antigen | Dopamine D5 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (LPPGSNGTAYC) corresponding to amino acids 2-10 of human dopamine D5 receptor,conjugated to carrier protein |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D5 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Antigen | Dopamine D2 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (CAARRAQELEME) corresponding to amino acids 272-282 of human D2 dopamine receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D2 receptor in rat brain. Does not cross-react with other dopamine receptors and exhibits minimal cross-reactivity with the D2S short receptor. |
Antigen | Dopamine D1 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry (Frozen) |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (MDGTGLVVERDFSC) corresponding to amino acids 9-21 of human D1,subscript_end;dopamine receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D1 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Antigen | Dopamine D3 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (ASLSQLSSHC) corresponding to amino acids (2-10) of human dopamine D3 receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D3 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Dopamine D1R/DRD1 Antibody (SG2-D1a), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody
Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse,Rat,Bovine (Negative),Canine (Negative),Human (Negative),Porcine (Negative),Rabbit (Negative) |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Frozen),Immunohistochemistry (Free Floating) |
Form | Purified |
Isotype | IgG2b κ |
Research Discipline | GPCR, Neuroscience, Neurotransmission |
Concentration | 1.0 mg/mL |
Antigen | Dopamine D1R/DRD1 |
Gene Symbols | DRD1 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Western Blot 1:200-1:500, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID 31462765), Immunohistochemistry-Frozen 1:1000, Immunohistochemistry Free-Floating |
Gene Alias | D(1A) dopamine receptor, D1DR, DADR, Dopamine D1 receptor, dopamine receptor D1, DRD1A |
Gene ID (Entrez) | 1812 |
Immunogen | Recombinant rat Dopamine Receptor D1 protein near the C-terminus. [Swiss-Prot# P18901] |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | This antibody is specific for Dopamine Receptor D1A. There is no cross-reactivity with D1B (D5) receptor. |
Clone | SG2-D1a |
Antigen | Dopamine D4 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide corresponding to amino acids 176-185 of human dopamine D4 receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the ∽48-51kDa dopamine D4 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Dopamine D1R/DRD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunofluorescence |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Neuroscience, Neurotransmission |
Antigen | Dopamine D1R/DRD1 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Gene Alias | D(1A) dopamine receptor, D1DR, DADR, Dopamine D1 receptor, dopamine receptor D1, DRD1A |
Gene ID (Entrez) | 1812 |
Formulation | PBS, pH 7.2, 40% glycerol |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine D5R/DRD5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Research Discipline | Cancer, GPCR, Neuroscience, Neurotransmission, Signal Transduction |
Antigen | Dopamine D5R/DRD5 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1.0 ug/ml |
Gene Alias | D(1B) dopamine receptor, D(5) dopamine receptor, D1beta dopamine receptor, Dopamine D5 receptor, dopamine receptor D1B, dopamine receptor D5, DRD1BDBDR, DRD1L2MGC10601 |
Gene ID (Entrez) | 1816 |
Formulation | PBS buffer, 2% sucrose |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human Dopamine D5R/DRD5 (NP_000789.1). Peptide sequence IVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDP |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine D5R/DRD5 Antibody (SG4-D1b), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 1 publication
Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse,Rat,Human (Negative) |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
Form | Purified |
Isotype | IgG1 κ |
Research Discipline | Cancer, GPCR, Neuroscience, Neurotransmission, Signal Transduction |
Concentration | 1 mg/mL |
Antigen | Dopamine D5R/DRD5 |
Gene Symbols | DRD5 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Western Blot 1:200-1:500, Immunohistochemistry 1:1000, Immunocytochemistry/Immunofluorescence 1:200-1:1000 |
Gene Alias | D(1B) dopamine receptor, D(5) dopamine receptor, D1beta dopamine receptor, Dopamine D5 receptor, dopamine receptor D1B, dopamine receptor D5, DRD1BDBDR, DRD1L2MGC10601 |
Gene ID (Entrez) | 1816 |
Immunogen | Recombinant rat Dopamine Receptor D5 (within the last 118 residues of the C-terminus). [Swiss-Prot# P25115] |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Rat. Reactivity with mouse has had mixed results. It does not react with human protein. |
Clone | SG4-D1b |