Primary Antibodies

Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1
–
15
of
183
results
Oxygen-regulated protein 1 Rabbit anti-Human∣Mouse∣Rat, Polyclonal, Bioss
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Cancer |
Antigen | Cathepsin K |
Gene Symbols | CTSK |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD |
Gene ID (Entrez) | 1513 |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Liquid |
Gene Accession No. | P56715 |
Isotype | IgG |
Concentration | 0.3 mg/mL |
Antigen | RP1 |
Gene Symbols | RP1 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | Dcdc3; DCDC4A; mG145; Orp1; oxygen-regulated protein 1; retinitis pigmentosa 1 (autosomal dominant); retinitis pigmentosa 1 (human); retinitis pigmentosa 1 homolog; retinitis pigmentosa 1 protein; Retinitis pigmentosa RP1 protein; retinitis pigmentosa RP1 protein homolog; RP1; Rp1h |
Gene | RP1 |
Product Type | Antibody |
Gene ID (Entrez) | 6101 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant protein corresponding to Human RP1. Recombinant protein control fragment (Product #RP-89748). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Host Species | Mouse |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry,Immunofluorescence |
Form | Purified |
Isotype | IgG2a |
Research Discipline | Hypoxia |
Antigen | ORP150/HSP12A |
Gene Symbols | HYOU1 |
Regulatory Status | RUO |
Purification Method | Protein G purified |
Dilution | Western Blot 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1:10 - 1:500 |
Gene Alias | 150 kDa oxygen-regulated protein, 170 kDa glucose-regulated protein, DKFZp686N08236, FLJ97572, glucose-regulated protein 170, GRP170, GRP-170, HSP12A, hypoxia up-regulated 1, hypoxia up-regulated protein 1, ORP-150, ORP150FLJ94899, oxygen regulated protein (150kD) |
Gene ID (Entrez) | 10525 |
Immunogen | Raised against a synthetic peptide of human GRP170 |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Detects 170kDa. |
Clone | 6G7-2H5 |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Western Blot |
Form | Liquid |
Gene Accession No. | Q8TD55 |
Isotype | IgG1 κ |
Antigen | PLEKHO2 |
Gene Symbols | PLEKHO2 |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | AI840980; PH domain-containing family O member 2; PH domain-containing family Q member 1; PH domain-containing protein; PH domain-containing protein homolog; pleckstrin homology domain containing O2; pleckstrin homology domain containing, family O member 2; pleckstrin homology domain containing, family Q member 1; pleckstrin homology domain-containing family O member 2; Pleckstrin homology domain-containing family Q member 1; PLEKHO2; Plekhq1; PP1628; pp9099 |
Gene | PLEKHO2 |
Product Type | Antibody |
Gene ID (Entrez) | 80301 |
Formulation | PBS with no preservative; pH 7.4 |
Immunogen | pp9099 (NP_079477, 392 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 3D9 |
Target Species | Human,Mouse,Rat |
---|---|
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry,Immunofluorescence |
Form | Purified |
Isotype | IgG2b |
Research Discipline | Hypoxia |
Antigen | ORP150/HSP12A |
Gene Symbols | HYOU1 |
Regulatory Status | RUO |
Purification Method | Protein G purified |
Dilution | Western Blot 1:100 - 1:2000, Immunocytochemistry/Immunofluorescence 1:10 - 1:500 |
Gene Alias | 150 kDa oxygen-regulated protein, 170 kDa glucose-regulated protein, DKFZp686N08236, FLJ97572, glucose-regulated protein 170, GRP170, GRP-170, HSP12A, hypoxia up-regulated 1, hypoxia up-regulated protein 1, ORP-150, ORP150FLJ94899, oxygen regulated protein (150kD) |
Gene ID (Entrez) | 10525 |
Immunogen | Recombinant Full length GRP170 Protein |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Detects 170 kDa. |
Clone | 6E3-2C3 |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,ELISA,Immunocytochemistry,Immunofluorescence |
Form | Purified |
Isotype | IgG1 κ |
Research Discipline | Cancer |
Concentration | 1 mg/mL |
Antigen | NDRG1 |
Gene Symbols | NDRG1 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Dilution | Western Blot 1:1000, Flow Cytometry 1:10-1:1025, ELISA, Immunocytochemistry/Immunofluorescence 1:100 |
Gene Alias | CAP43, CMT4D, Differentiation-related gene 1 protein, DRG-1, DRG1HMSNL, NDR1, Nickel-specific induction protein Cap43, NMSL, N-myc downstream regulated 1, N-myc downstream-regulated gene 1 protein, protein NDRG1, protein regulated by oxygen-1, PROXY1, Reducing agents and tunicamycin-responsive protein, RIT42, RTPGC4, TARG1, TDD5, tunicamycin-responsive protein |
Gene ID (Entrez) | 10397 |
Formulation | Liquid. In PBS (pH 7.4), 10% Glycerol with 0.02% Sodium Azide |
Immunogen | Recombinant human NDRG1 (1-394aa) purified from E. coli |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 11G4 |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin),Immunocytochemistry |
Form | Liquid |
Gene Accession No. | Q8TD55 |
Isotype | IgG |
Concentration | 0.2 mg/mL |
Antigen | PLEKHO2 |
Gene Symbols | PLEKHO2 |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | AI840980; PH domain-containing family O member 2; PH domain-containing family Q member 1; PH domain-containing protein; PH domain-containing protein homolog; pleckstrin homology domain containing O2; pleckstrin homology domain containing, family O member 2; pleckstrin homology domain containing, family Q member 1; pleckstrin homology domain-containing family O member 2; Pleckstrin homology domain-containing family Q member 1; PLEKHO2; Plekhq1; PP1628; pp9099 |
Gene | PLEKHO2 |
Product Type | Antibody |
Gene ID (Entrez) | 80301 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant protein corresponding to Human PLEKHO2. Recombinant protein control fragment (Product #RP-98130). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Liquid |
Gene Accession No. | Q9HA92 |
Isotype | IgG |
Concentration | 0.3 mg/mL |
Antigen | RSAD1 |
Gene Symbols | RSAD1 |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography |
Gene Alias | B430319G23; BC056485; oxygen-independent coproporphyrinogen-III oxidase-like protein RSAD1; Putative heme chaperone; radical S-adenosyl methionine domain containing 1; radical S-adenosyl methionine domain-containing protein 1, mitochondrial; RSAD1 |
Gene | RSAD1 |
Product Type | Antibody |
Gene ID (Entrez) | 55316 |
Formulation | PBS with 40% glycerol and 0.02% sodium azide; pH 7.2 |
Immunogen | Recombinant protein corresponding to Human RSAD1. Recombinant protein control fragment (Product #RP-93324). |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry |
Form | Liquid |
Gene Accession No. | Q9BQA9 |
Isotype | IgG1 |
Concentration | 1 mg/mL |
Antigen | C17orf62 |
Gene Symbols | C17ORF62 |
Regulatory Status | RUO |
Purification Method | Affinity chromatography |
Gene Alias | C17orf62; chromosome 17 open reading frame 62; CYBC1; Cytochrome b-245 chaperone 1; EROS; Essential for reactive oxygen species protein; HAPSTR1; uncharacterized protein C17orf62 |
Gene | C17ORF62 |
Product Type | Antibody |
Gene ID (Entrez) | 79415 |
Formulation | PBS with 1% BSA, 50% glycerol and 0.02% sodium azide; pH 7.3 |
Immunogen | Full length human recombinant protein of C17orf62 produced in HEK293T cell. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | OTI2B8 |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot |
Form | Liquid |
Gene Accession No. | Q9HA92 |
Isotype | IgG |
Concentration | 0.5 mg/mL |
Antigen | RSAD1 |
Gene Symbols | RSAD1 |
Regulatory Status | RUO |
Purification Method | Antigen Affinity Chromatography, Protein A |
Gene Alias | B430319G23; BC056485; oxygen-independent coproporphyrinogen-III oxidase-like protein RSAD1; Putative heme chaperone; radical S-adenosyl methionine domain containing 1; radical S-adenosyl methionine domain-containing protein 1, mitochondrial; RSAD1 |
Gene | RSAD1 |
Product Type | Antibody |
Gene ID (Entrez) | 55316 |
Formulation | PBS with 0.09% sodium azide; pH 7.4 |
Immunogen | KLH conjugated synthetic peptide between 299-328 amino acids from the C-terminal region of human RSAD1. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | NP_000387 |
Research Discipline | Cancer |
Antigen | Cathepsin K |
Gene Symbols | CTSK |
Regulatory Status | RUO |
Molecular Weight of Antigen | 37 kDa |
Gene Alias | cathepsin K, cathepsin K (pycnodysostosis), Cathepsin O, cathepsin O1, Cathepsin O2, Cathepsin X, CTS02, CTSO, CTSO1, CTSO2, EC 3.4.22, EC 3.4.22.38, MGC23107, PKND, PYCD |
Gene ID (Entrez) | 1513 |
Immunogen | Synthetic peptide directed towards the middle region of human CTSK. Peptide sequence SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY. |
Classification | Polyclonal |
Primary or Secondary | Primary |