All Primary Antibodies

All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1,156)
- (2,126)
- (150)
- (10)
- (37)
- (1)
- (3)
- (13)
- (25)
- (34)
- (12)
- (1)
- (13)
- (28)
- (29)
- (14)
- (49)
- (2)
- (2)
- (13)
- (24)
- (24)
- (24)
- (24)
- (10)
- (25)
- (24)
- (24)
- (57)
- (2)
- (6)
- (24)
- (15)
- (11)
- (15)
- (15)
- (11)
- (15)
- (43)
- (2)
- (1)
- (8)
- (1)
- (1)
- (26)
- (1)
- (9)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2,688)
- (3)
- (7)
- (6)
- (6)
- (6)
- (1)
- (11)
- (113)
- (6)
- (3)
- (998)
- (2,192)
- (79)
- (39)
- (4)
- (6)
- (3)
- (433)
- (7)
- (78)
- (7)
- (1)
- (7)
- (2)
- (13)
- (1)
- (1,555)
- (603)
- (62)
- (72)
- (9)
- (21)
- (5)
- (55)
- (26)
- (47)
- (34)
- (49)
- (90)
- (8)
- (2)
- (78)
- (1)
- (49)
- (53)
- (35)
- (21)
- (4)
- (1)
- (5)
- (3)
- (4)
- (175)
- (93)
- (16)
- (2)
- (5)
- (1)
- (49)
- (15)
- (3)
- (12)
- (64)
- (17)
- (3,214)
- (1)
- (1)
- (1)
- (2)
- (1,502)
- (5)
- (1)
- (70)
- (7)
- (4)
- (94)
- (1)
- (1)
- (113)
- (1,096)
- (5)
- (1)
- (1)
- (2)
- (1)
- (3)
- (5)
- (3)
- (16)
Filtered Search Results

Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Human,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P41180, P48442 |
Concentration | 1 mg/mL |
Antigen | Calcium Sensing Receptor |
Gene Symbols | CASR |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | BoPCaR1; Ca sensing receptor; Ca(2+)-sensing receptor; calcium sensing receptor; calcium-sensing receptor; Calcium-sensing receptor (hypocalciuric hypercalcemia 1 severe neonatal hyperparathyroidism); Calcium-sensing receptor (hypocalciuric hypercalcemia 1, severe neonatal hyperparathyroidism); CaR; CaSR; CaSR antibody; cation sensing receptor; EIG8; Extracellular calcium-sensing receptor; FHH; FIH; G protein coupled receptor, family C, group 2, member A; G protein-coupled receptor, family C, group 2, member A; Gprc2a; HHC; HHC1; HYPOC1; LOW QUALITY PROTEIN: extracellular calcium-sensing receptor; NSHPT; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; Parathyroid cell calcium-sensing receptor 1; PCaR1 |
Gene | CASR |
Product Type | Antibody |
Gene ID (Entrez) | 24247, 846 |
Formulation | PBS with 0.05% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Canine,Guinea Pig,Human,Mouse,Rabbit,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
Form | Liquid |
Isotype | IgM |
Gene Accession No. | P23685, P32418, P48766, P70414, Q01728 |
Concentration | 1 mg/mL |
Antigen | Sodium/Calcium Exchanger |
Gene Symbols | SLC8A1 |
Regulatory Status | RUO |
Purification Method | Affinity chromatography - MBP |
Gene Alias | AI852629; AV344025; cardiac sarcolemmal sodium-calcium exchanger; CNC; D930008O12Rik; isoform NCX1.13; isoform NCX1.3; isoform NCX1.9; Na(+)/Ca(2+)-exchange protein 1; Na/Ca exchanger; Na/Ca exchanger NACA1 isoform; Na+/C2+ exchanger; Na+/Ca++ exchanger; Na+/Ca2+ exchanger; NACA; Na-Ca exchanger; Ncx; Ncx1; NKX; renal Na/Ca exchanger NACA-2; sarcolemmal sodium/calcium exchanger; SLC8A1; sodium/calcium exchanger; sodium/calcium exchanger 1; sodium/calcium exchanger isoform NaCa13; sodium/calcium exchanger isoform NaCa3; sodium/calcium exchanger isoform NaCa7; sodium/calcium exchanger isoform NaCa9; sodium-calcium exchanger; solute carrier family 8 (sodium/calcium exchanger), member 1; solute carrier family 8 member 1; solute carrier family 8 member A1; solute carrier family 8, member 1 |
Gene | SLC8A1 |
Product Type | Antibody |
Gene ID (Entrez) | 100135620, 100328570, 20541, 29715, 475738, 6546 |
Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | C2C12 |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Bovine,Human,Mouse,Rat |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | ELISA,Immunohistochemistry (Frozen),Western Blot |
Form | Liquid |
Isotype | IgG2a |
Gene Accession No. | P35384, P41180, P48442, Q9QY96 |
Concentration | 1 mg/mL |
Antigen | Calcium Sensing Receptor |
Gene Symbols | CASR |
Regulatory Status | RUO |
Purification Method | Protein A |
Gene Alias | BoPCaR1; Ca sensing receptor; Ca(2+)-sensing receptor; calcium sensing receptor; calcium-sensing receptor; Calcium-sensing receptor (hypocalciuric hypercalcemia 1 severe neonatal hyperparathyroidism); Calcium-sensing receptor (hypocalciuric hypercalcemia 1, severe neonatal hyperparathyroidism); CaR; CaSR; CaSR antibody; cation sensing receptor; EIG8; Extracellular calcium-sensing receptor; FHH; FIH; G protein coupled receptor, family C, group 2, member A; G protein-coupled receptor, family C, group 2, member A; Gprc2a; HHC; HHC1; HYPOC1; LOW QUALITY PROTEIN: extracellular calcium-sensing receptor; NSHPT; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; Parathyroid cell calcium-sensing receptor 1; PCaR1 |
Gene | CASR |
Product Type | Antibody |
Gene ID (Entrez) | 12374, 24247, 281038, 846 |
Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | 5C10, ADD,ADD |
calcium homeostasis modulator 2 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Antigen | calcium homeostasis modulator 2 |
Gene Symbols | CALHM2 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500 |
Gene Alias | calcium homeostasis modulator 2, calcium homeostasis modulator protein 2, FAM26Bfamily with sequence similarity 26, member B, Protein FAM26B |
Gene ID (Entrez) | 51063 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RGEAYVCALSEFVDPSSLTAREEHFPSAHATEILARFPCKENPDNLSDFREEVSRRLRYESQ |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of human calcium homeostasis modulator 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Calcium-binding-protein-P22 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Wnt Signaling Pathway |
Antigen | Calcium-binding-protein-P22 |
Gene Symbols | CHP1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20 |
Gene Alias | Calcineurin B homolog, Calcineurin homologous protein, calcium binding protein P22, Calcium-binding protein CHP, calcium-binding protein p22, SLC9A1 binding protein, SLC9A1BP |
Gene ID (Entrez) | 11261 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNIS |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Calcium-sensing R/CaSR Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 1 publication
Target Species | Human,Mouse |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P41180 |
Research Discipline | Cytoskeleton Markers, Extracellular Matrix, GPCR, Growth and Development, Lipid and Metabolism, Neuroscience, Neurotransmission, Signal Transduction |
Antigen | Calcium-sensing R/CaSR |
Gene Symbols | CASR |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | calcium-sensing receptor, CAR, CaSR, EIG8, extracellular calcium-sensing receptor, FHH, FIH, GPRC2AHHC, HHC1, hypocalciuric hypercalcemia 1, NSHPT, parathyroid Ca(2+)-sensing receptor 1, Parathyroid cell calcium-sensing receptor, PCaR1, PCAR1MGC138441 |
Gene ID (Entrez) | 846 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Sodium-Calcium Exchanger Antibody (C2C12), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Mouse Monoclonal Antibody has been used in 2 publications
Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Ascites |
Isotype | IgM |
Concentration | 1 mg/ml |
Antigen | Sodium-Calcium Exchanger |
Gene Symbols | SLC8A3 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:1000, Flow Cytometry 1:100, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 1:10 - 1:500, Immunohistochemistry-Paraffin 1:100, Immunohistochemistry-Frozen 1:100 |
Gene Alias | Na(+)/Ca(2+)-exchange protein 3, Na+/Ca2+ exchanger 3, NCX3sodium/calcium exchanger SLC8A3, sodium/calcium exchanger 3, solute carrier family 8 (sodium/calcium exchanger), member 3, solute carrier family 8 (sodium-calcium exchanger), member 3 |
Gene ID (Entrez) | 6547 |
Immunogen | Purified canine cardiac sodium/calcium exchanger. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Sodium Calcium Exchanger (C2C12) |
Clone | C2C12 |
calcium homeostasis modulator 2 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Cell Biology |
Antigen | calcium homeostasis modulator 2 |
Regulatory Status | RUO |
Purification Method | Antigen and protein A Affinity-purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | calcium homeostasis modulator 2, calcium homeostasis modulator protein 2, FAM26Bfamily with sequence similarity 26, member B, Protein FAM26B |
Gene ID (Entrez) | 51063 |
Formulation | PBS (pH 7.0) |
Immunogen | Produced in rabbits immunized with E. coli-derived Human calcium homeostasis modulator 2 fragment. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Calcium Activated Nucleotidase 1/CANT1 |
Gene Symbols | CANT1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1 |
Gene ID (Entrez) | 124583 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody has been used in 1 publication
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Lipid and Metabolism |
Antigen | Calcium Activated Nucleotidase 1/CANT1 |
Gene Symbols | CANT1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200 |
Gene Alias | Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1 |
Gene ID (Entrez) | 124583 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | Q8WVQ1 |
Research Discipline | Lipid and Metabolism |
Antigen | Calcium Activated Nucleotidase 1/CANT1 |
Gene Symbols | CANT1 |
Regulatory Status | RUO |
Gene Alias | Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1 |
Gene ID (Entrez) | 124583 |
Immunogen | Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Sodium Calcium Exchanger 1/NCX1 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | Sodium Calcium Exchanger 1/NCX1 |
Gene Symbols | SLC8A1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | FLJ37694, FLJ43417, Na(+)/Ca(2+)-exchange protein 1, sodium/calcium exchanger 1, solute carrier family 8 (sodium/calcium exchanger), member 1 |
Gene ID (Entrez) | 6546 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P41180, P48442 |
Antigen | Calcium Sensing Receptor |
Gene Symbols | CASR |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | BoPCaR1; Ca sensing receptor; Ca(2+)-sensing receptor; calcium sensing receptor; calcium-sensing receptor; Calcium-sensing receptor (hypocalciuric hypercalcemia 1 severe neonatal hyperparathyroidism); Calcium-sensing receptor (hypocalciuric hypercalcemia 1, severe neonatal hyperparathyroidism); CaR; CaSR; CaSR antibody; cation sensing receptor; EIG8; Extracellular calcium-sensing receptor; FHH; FIH; G protein coupled receptor, family C, group 2, member A; G protein-coupled receptor, family C, group 2, member A; Gprc2a; HHC; HHC1; HYPOC1; LOW QUALITY PROTEIN: extracellular calcium-sensing receptor; NSHPT; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; Parathyroid cell calcium-sensing receptor 1; PCaR1 |
Gene | CASR |
Product Type | Antibody |
Gene ID (Entrez) | 24247, 846 |
Formulation | PBS with 1% BSA and <0.1% sodium azide; pH 7.6 |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry (Paraffin) |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P41180 |
Concentration | 1 mg/mL |
Antigen | Calcium Sensing Receptor |
Gene Symbols | CASR |
Regulatory Status | RUO |
Purification Method | Antigen affinity chromatography |
Gene Alias | BoPCaR1; Ca sensing receptor; Ca(2+)-sensing receptor; calcium sensing receptor; calcium-sensing receptor; Calcium-sensing receptor (hypocalciuric hypercalcemia 1 severe neonatal hyperparathyroidism); Calcium-sensing receptor (hypocalciuric hypercalcemia 1, severe neonatal hyperparathyroidism); CaR; CaSR; CaSR antibody; cation sensing receptor; EIG8; Extracellular calcium-sensing receptor; FHH; FIH; G protein coupled receptor, family C, group 2, member A; G protein-coupled receptor, family C, group 2, member A; Gprc2a; HHC; HHC1; HYPOC1; LOW QUALITY PROTEIN: extracellular calcium-sensing receptor; NSHPT; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; Parathyroid cell calcium-sensing receptor 1; PCaR1 |
Gene | CASR |
Product Type | Antibody |
Gene ID (Entrez) | 846 |
Formulation | PBS with 0.1% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |
Sodium-Calcium Exchanger Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody