accessibility menu, dialog, popup

UserName
Viewing profile as user:

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

Show all

special offers

  • (1)
  • (1)

brands

  • (2)
  • (92)
  • (8)
  • (3)
  • (7)
  • (16)
  • (6)
  • (41)
  • (9)
  • (13)
  • (40)
  • (7)
  • (1)
  • (1)
  • (3)
  • (4)
  • (14)
  • (9)
  • (23)
  • (31)
  • (1)
  • (62)
  • (5)
  • (3)
  • (221)
  • (6)
  • (5)
  • (182)
  • (11)
  • (3)
  • (10)
  • (3)
  • (3)
  • (173)
  • (23)
  • (3)
  • (123)
  • (1)
  • (1)

special interests

  • (11)
  • (2)
  • (157)
  • (321)

Quantity

  • (4)
  • (2)
  • (1)
  • (128)
  • (1)
  • (5)
  • (2)
Show all

Conjugate

  • (1)
  • (2)
  • (4)
  • (5)
  • (5)
  • (4)
  • (4)
Show all

Target Species

  • (1)
  • (2)
  • (17)
  • (25)
  • (14)
  • (25)
  • (1)
Show all

Classification

  • (207)
  • (271)
  • (18)
  • (1)

Host Species

  • (1)
  • (14)
  • (1)
  • (191)
  • (272)
  • (7)
  • (11)

Applications

  • (51)
  • (1)
  • (69)
  • (96)
  • (2)
  • (2)
  • (6)
Show all

Isotype

  • (264)
  • (27)
  • (32)
  • (16)
  • (80)
  • (1)
  • (7)
Show all

Regulatory Status

  • (457)

Form

  • (1)
  • (246)
  • (24)
  • (3)
  • (157)
  • (1)
  • (3)
Show all

For Use With (Application)

  • (1)
  • (1)
  • (25)
  • (25)
  • (3)
  • (6)
  • (6)
Show all

Search results for "dopamine"

1 – 15 of 955 results
Antibodies (88)
Recombinant proteins and peptides (5)
ELISA kits (1)
TaqMan™ assays and arrays (4703)
Branched DNA gene expression assays (267)
PCR and Sanger sequencing primers (553)
siRNA (3647)
1

Dopamine hydrochloride, 99%

CAS: 62-31-7 Molecular Formula: C8H12ClNO2 Molecular Weight (g/mol): 189.64 MDL Number: MFCD00012898 InChI Key: CTENFNNZBMHDDG-UHFFFAOYSA-N Synonym: dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril PubChem CID: 65340 IUPAC Name: 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride SMILES: [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1

EDGE
PubChem CID 65340
CAS 62-31-7
Molecular Weight (g/mol) 189.64
MDL Number MFCD00012898
SMILES [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1
Synonym dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril
IUPAC Name 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride
InChI Key CTENFNNZBMHDDG-UHFFFAOYSA-N
Molecular Formula C8H12ClNO2
2

Invitrogen™ Dopamine beta Hydroxylase Polyclonal Antibody

Sheep Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat,Bovine
Host Species Sheep
Conjugate Unconjugated
Applications Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P09172, P15101, Q05754, Q64237
Isotype IgG
Concentration Conc. Not Determined
Antigen Dopamine beta Hydroxylase
Gene Symbols DBH
Regulatory Status RUO
Gene Alias Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase
Gene DBH
Product Type Antibody
Gene ID (Entrez) 13166, 1621, 25699, 280758
Formulation Whole serum with 0.05% sodium azide
Immunogen Synthetic peptide corresponding to residues S(43) E P P E S P F P Y H I P L D P E G T L(62) of rat DBH.
Classification Polyclonal
Primary or Secondary Primary
3

Tocris™ CNV Dopamine
GREENER_CHOICE

Caged dopamine; photolysed by UV light

4

Invitrogen™ Dopamine beta Hydroxylase Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P09172
Isotype IgG
Concentration 0.04 mg/mL
Antigen Dopamine beta Hydroxylase
Gene Symbols DBH
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase
Gene DBH
Product Type Antibody
Gene ID (Entrez) 1621
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Recombinant Protein corresonding to Human Dopamine beta Hydroxylase. Recombinant protein control fragment (Product #RP-105510).
Classification Polyclonal
Primary or Secondary Primary
5

Dopamine D3R/DRD3 Antibody (SR1747), Novus Biologicals™
SDP

Rabbit Monoclonal Antibody

Content And Storage Store at -20° C. Avoid freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline GPCR
Antigen Dopamine D3R/DRD3
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:2000
Gene Alias D(3) dopamine receptor, D3DR, Dopamine D3 receptor, dopamine receptor D3, essential tremor 1, ETM1, FET1, MGC149204, MGC149205
Gene ID (Entrez) 1814
Formulation PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Immunogen A synthesized peptide derived from human Dopamine D3R/DRD3 (Uniprot #: P35462)
Classification Monoclonal
Primary or Secondary Primary
Clone SR1747
6

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Mouse,Rat,Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P23977, Q61327
Isotype IgG
Concentration 1.93 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 80787
Formulation PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Recombinant protein encompassing a sequence within the C-terminus region of Mouse Dopamine Transporter. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
7

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P23977, Q01959, Q61327
Isotype IgG
Concentration 1 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 6531
Formulation PBS with 50% glycerol and 0.02% sodium azide; pH 7.4
Immunogen A synthesized peptide derived from human SLC6A3(Accession Q01959), corresponding to amino acid residues G481-F531.
Classification Polyclonal
Primary or Secondary Primary
8

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P23977, Q01959, Q61327
Isotype IgG
Concentration 0.84 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 6531
Formulation PBS with 50% glycerol and 0.05% ProClin 300; pH 7.3
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Transporter/SLC6A3 (NP_0010351).
Classification Polyclonal
Primary or Secondary Primary
9

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Form Liquid
Gene Accession No. Q01959
Isotype IgG
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 6531
Formulation PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen Recombinant Protein corresonding to Human Dopamine Transporter. Recombinant protein control fragment (Product #RP-108307).
Classification Polyclonal
Primary or Secondary Primary
10

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Monkey
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Frozen),Western Blot
Form Liquid
Gene Accession No. Q01959
Isotype IgG
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity Chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 6531
Formulation 0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and no preservative; pH 7.5
Immunogen Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region of human SLC6A3 conjugated to KLH.
Classification Polyclonal
Primary or Secondary Primary
11

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat,Monkey
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot
Form Liquid
Gene Accession No. P23977, Q01959, Q61327
Isotype IgG
Concentration 0.30 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 24898, 6531
Formulation 0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and no preservative; pH 7.5
Immunogen Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region of human SLC6A3 conjugated to KLH.
Classification Polyclonal
Primary or Secondary Primary
12

Dopamine beta-Hydroxylase Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Cancer, Lipid and Metabolism, Neuroscience
Antigen Dopamine beta-Hydroxylase
Gene Symbols DBH
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1
Gene ID (Entrez) 1621
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
13

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Monkey
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Frozen),Western Blot
Form Liquid
Gene Accession No. Q01959, Q61327
Isotype IgG
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 13162, 6531
Formulation 0.01M HEPES with 0.01% BSA, 50% glycerol, 0.15M NaCl and 0.09% sodium azide; pH 7.5
Immunogen Synthetic peptide corresponding to the c-terminus region of human dopamine transporter conjugated to KLH.
Classification Polyclonal
Primary or Secondary Primary
14

Invitrogen™ Dopamine Transporter Polyclonal Antibody

Goat Polyclonal Antibody

Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Goat
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. Q01959
Isotype IgG
Concentration 0.5 mg/mL
Antigen Dopamine Transporter
Gene Symbols Slc6a3
Regulatory Status RUO
Purification Method Ammonium Sulfate Precipitation
Gene Alias DA transporter; Dat; Dat1; dopamine transporter; dopamine transporter 1; PKDYS; SLC6A3; Sodium-dependent dopamine transporter; solute carrier family 6 (neurotransmitter transporter), member 3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; solute carrier family 6 member 3; solute carrier family 6, member 3
Gene Slc6a3
Product Type Antibody
Gene ID (Entrez) 6531
Formulation TBS with 0.5% BSA and 0.02% sodium azide; pH 7.3
Immunogen Peptide with sequence C-QLTSSTLTNPRQSP (aa 41-54).
Classification Polyclonal
Primary or Secondary Primary
15

Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline GPCR, Neuroscience
Antigen Dopamine Receptor D4
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin
Gene Alias D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor
Gene ID (Entrez) 1815
Formulation PBS with 50% glycerol, pH7.3.
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRD4 (NP_000788.2). AWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCS
Classification Polyclonal
Primary or Secondary Primary