Filtered Search Results
Search results for "dopamine"

Dopamine hydrochloride, 99%, Thermo Scientific Chemicals
CAS: 62-31-7 Molecular Formula: C8H12ClNO2 Molecular Weight (g/mol): 189.64 MDL Number: MFCD00012898 InChI Key: CTENFNNZBMHDDG-UHFFFAOYSA-N Synonym: dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril PubChem CID: 65340 IUPAC Name: 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride SMILES: [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1

PubChem CID | 65340 |
---|---|
CAS | 62-31-7 |
Molecular Weight (g/mol) | 189.64 |
MDL Number | MFCD00012898 |
SMILES | [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1 |
Synonym | dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril |
IUPAC Name | 4-(2-aminoethyl)benzene-1,2-diol;hydrochloride |
InChI Key | CTENFNNZBMHDDG-UHFFFAOYSA-N |
Molecular Formula | C8H12ClNO2 |
Content And Storage | -20° C, Avoid Freeze/Thaw Cycles |
---|---|
Target Species | Bovine,Human,Mouse,Rat |
Host Species | Sheep |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunohistochemistry (Frozen),Western Blot |
Form | Liquid |
Isotype | IgG |
Gene Accession No. | P09172, P15101, Q05754, Q64237 |
Concentration | Conc. Not Determined |
Antigen | Dopamine beta Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Gene Alias | Dbh; DBM; dopamine beta hydroxylase; Dopamine beta hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase; dopamine beta-hydroxylase (dopamine beta-monooxygenase); dopamine beta-hydroxylase precursor; dopamine beta-hydroxylase precursor (EC 1.14.17.1); dopamine beta-monooxygenase; dopamine beta-monooxygenase precursor (EC 1.14.17.1); Dopamine-Beta-hydroxylase; DOPBHY; mixed function oxidase; Soluble dopamine beta-hydroxylase |
Gene | DBH |
Product Type | Antibody |
Gene ID (Entrez) | 13166, 1621, 25699, 280758 |
Formulation | whole serum with 0.05% sodium azide |
Classification | Polyclonal |
Primary or Secondary | Primary |
Tocris™ CNV Dopamine
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Caged dopamine; photolysed by UV light
Dopamine D3R/DRD3 Antibody (SR1747), Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Monoclonal Antibody
Content And Storage | Store at -20° C. Avoid freeze/thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR |
Antigen | Dopamine D3R/DRD3 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | D(3) dopamine receptor, D3DR, Dopamine D3 receptor, dopamine receptor D3, essential tremor 1, ETM1, FET1, MGC149204, MGC149205 |
Gene ID (Entrez) | 1814 |
Formulation | PBS, pH 7.4, 150mM NaCl, 50% glycerol. |
Immunogen | A synthesized peptide derived from human Dopamine D3R/DRD3 (Uniprot #: P35462) |
Classification | Monoclonal |
Primary or Secondary | Primary |
Clone | SR1747 |
Dopamine beta-Hydroxylase Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Research Discipline | Cancer, Lipid and Metabolism, Neuroscience |
Antigen | Dopamine beta-Hydroxylase |
Gene Symbols | DBH |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Gene Alias | DBM, dopamine beta-hydroxylase, dopamine beta-hydroxylase (dopamine beta-monooxygenase), Dopamine beta-monooxygenase, EC 1.14.17.1 |
Gene ID (Entrez) | 1621 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Neuroscience |
Antigen | Dopamine Receptor D4 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
Gene Alias | D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor |
Gene ID (Entrez) | 1815 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRD4 (NP_000788.2). AWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCS |
Classification | Polyclonal |
Primary or Secondary | Primary |
Dopamine Receptor D4 Antibody - BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | GPCR, Neuroscience |
Antigen | Dopamine Receptor D4 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:1000 |
Gene Alias | D(2C) dopamine receptor, D(4) dopamine receptor, D4DR, Dopamine D4 receptor, dopamine receptor D4, seven transmembrane helix receptor |
Gene ID (Entrez) | 1815 |
Formulation | PBS with 50% glycerol, pH7.3. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D4 (P21917). MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGA |
Classification | Polyclonal |
Primary or Secondary | Primary |
Novus Biologicals™ Dopamine D5R/DRD5 Overexpression Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Dopamine hydrochloride, Tocris Bioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More

Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
CAS: 62-31-7 Molecular Formula: C8H12ClNO2 Molecular Weight (g/mol): 189.64 MDL Number: MFCD00012898 InChI Key: CTENFNNZBMHDDG-UHFFFAOYSA-N Synonym: dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril PubChem CID: 65340 IUPAC Name: hydrogen 4-(2-aminoethyl)benzene-1,2-diol chloride SMILES: [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1
PubChem CID | 65340 |
---|---|
CAS | 62-31-7 |
Molecular Weight (g/mol) | 189.64 |
MDL Number | MFCD00012898 |
SMILES | [H+].[Cl-].NCCC1=CC=C(O)C(O)=C1 |
Synonym | dopamine hydrochloride,3-hydroxytyramine hydrochloride,dopamine hcl,4-2-aminoethyl benzene-1,2-diol hydrochloride,intropin,dopastat,revivan,dynatra,3,4-dihydroxyphenethylamine hydrochloride,cardiosteril |
IUPAC Name | hydrogen 4-(2-aminoethyl)benzene-1,2-diol chloride |
InChI Key | CTENFNNZBMHDDG-UHFFFAOYSA-N |
Molecular Formula | C8H12ClNO2 |
Antigen | Dopamine D5 Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Flow Cytometry,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic peptide (LPPGSNGTAYC) corresponding to amino acids 2-10 of human dopamine D5 receptor,conjugated to carrier protein |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the dopamine D5 receptor in rat brain. Does not cross-react with other dopamine receptors. |
Antigen | Dopamine D2S Receptor |
---|---|
Regulatory Status | RUO |
Content And Storage | 2°C to 8°C |
Host Species | Rabbit |
Applications | ELISA,Immunoblot,Immunoblot,Immunohistochemistry |
Form | Undiluted |
Formulation | Undiluted serum. |
Immunogen | a synthetic (PLKEAARRC) peptide corresponding to amino acids 239-246 of human D2s dopamine receptor |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |
Test Specificity | Recognizes the ∽48kDa dopamine D25 receptor. Does not cross-react with other dopamine receptors. |
Novus Biologicals™ Dopamine beta-Hydroxylase Overexpression Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Novus Biologicals™ Dopamine D1R/DRD1 Overexpression Lysate
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More