accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (4,284)
Primary Antibody Matched Pairs (4)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

calcium

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (13)
  • (38)
  • (45)
  • (6)
  • (1)
  • (1)
  • (1)
  • (1)
  • (44)
  • (2)
  • (5)
  • (1)
  • (31)
  • (4)
  • (7)
  • (598)
  • (1)
  • (4)
  • (1)
  • (10)
  • (6)
  • (3)
  • (1)
  • (1)
  • (1,514)
  • (14)
  • (8)
  • (1)
  • (27)
  • (887)
  • (1)
  • (1)
  • (21)
  • (114)
  • (1)
  • (13)
  • (21)
  • (15)
  • (2,169)
  • (3)

special interests

  • (1)
  • (101)
  • (111)
  • (1,588)

Classification

  • (1,196)
  • (2,127)
  • (164)
  • (10)

Conjugate

  • (38)
  • (1)
  • (3)
  • (15)
  • (25)
  • (36)
  • (14)
Show all

Host Species

  • (1)
  • (11)
  • (112)
  • (6)
  • (3)
  • (1,037)
  • (2,208)
Show all

Quantity

  • (4)
  • (6)
  • (3)
  • (475)
  • (7)
  • (78)
  • (7)
Show all

Target Species

  • (5)
  • (3)
  • (4)
  • (175)
  • (93)
  • (16)
  • (2)
Show all

Applications

  • (2)
  • (4)
  • (3)
  • (81)
  • (9)
  • (652)
  • (599)
Show all

Isotype

  • (5)
  • (2,294)
  • (43)
  • (1)
  • (435)
  • (173)
  • (8)
Show all

Regulatory Status

  • (3,414)

Form

  • (3)
  • (2,312)
  • (135)
  • (717)
  • (14)
  • (17)

Research Discipline

  • (3)
  • (1)
1 – 15 of 4,090 results
1

Calcium Sensing Receptor Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Human,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Western Blot
Form Liquid
Isotype IgG
Gene Accession No. P41180, P48442
Concentration 1 mg/mL
Antigen Calcium Sensing Receptor
Gene Symbols CASR
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias BoPCaR1; Ca sensing receptor; Ca(2+)-sensing receptor; calcium sensing receptor; calcium-sensing receptor; Calcium-sensing receptor (hypocalciuric hypercalcemia 1 severe neonatal hyperparathyroidism); Calcium-sensing receptor (hypocalciuric hypercalcemia 1, severe neonatal hyperparathyroidism); CaR; CaSR; CaSR antibody; cation sensing receptor; EIG8; Extracellular calcium-sensing receptor; FHH; FIH; G protein coupled receptor, family C, group 2, member A; G protein-coupled receptor, family C, group 2, member A; Gprc2a; HHC; HHC1; HYPOC1; LOW QUALITY PROTEIN: extracellular calcium-sensing receptor; NSHPT; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; Parathyroid cell calcium-sensing receptor 1; PCaR1
Gene CASR
Product Type Antibody
Gene ID (Entrez) 24247, 846
Formulation PBS with 0.05% sodium azide
Classification Polyclonal
Primary or Secondary Primary
2

Sodium/Calcium Exchanger Monoclonal Antibody (C2C12), Invitrogen™

Mouse Monoclonal Antibody

EDGE
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Canine,Guinea Pig,Human,Mouse,Rabbit,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Liquid
Isotype IgM
Gene Accession No. P23685, P32418, P48766, P70414, Q01728
Concentration 1 mg/mL
Antigen Sodium/Calcium Exchanger
Gene Symbols SLC8A1
Regulatory Status RUO
Purification Method Affinity chromatography - MBP
Gene Alias AI852629; AV344025; cardiac sarcolemmal sodium-calcium exchanger; CNC; D930008O12Rik; isoform NCX1.13; isoform NCX1.3; isoform NCX1.9; Na(+)/Ca(2+)-exchange protein 1; Na/Ca exchanger; Na/Ca exchanger NACA1 isoform; Na+/C2+ exchanger; Na+/Ca++ exchanger; Na+/Ca2+ exchanger; NACA; Na-Ca exchanger; Ncx; Ncx1; NKX; renal Na/Ca exchanger NACA-2; sarcolemmal sodium/calcium exchanger; SLC8A1; sodium/calcium exchanger; sodium/calcium exchanger 1; sodium/calcium exchanger isoform NaCa13; sodium/calcium exchanger isoform NaCa3; sodium/calcium exchanger isoform NaCa7; sodium/calcium exchanger isoform NaCa9; sodium-calcium exchanger; solute carrier family 8 (sodium/calcium exchanger), member 1; solute carrier family 8 member 1; solute carrier family 8 member A1; solute carrier family 8, member 1
Gene SLC8A1
Product Type Antibody
Gene ID (Entrez) 100135620, 100328570, 20541, 29715, 475738, 6546
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Classification Monoclonal
Primary or Secondary Primary
Clone C2C12
3

Calcium Sensing Receptor Monoclonal Antibody (5C10, ADD), Invitrogen™

Mouse Monoclonal Antibody

EDGE
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Target Species Bovine,Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Immunohistochemistry (Frozen),Western Blot
Form Liquid
Isotype IgG2a
Gene Accession No. P35384, P41180, P48442, Q9QY96
Concentration 1 mg/mL
Antigen Calcium Sensing Receptor
Gene Symbols CASR
Regulatory Status RUO
Purification Method Protein A
Gene Alias BoPCaR1; Ca sensing receptor; Ca(2+)-sensing receptor; calcium sensing receptor; calcium-sensing receptor; Calcium-sensing receptor (hypocalciuric hypercalcemia 1 severe neonatal hyperparathyroidism); Calcium-sensing receptor (hypocalciuric hypercalcemia 1, severe neonatal hyperparathyroidism); CaR; CaSR; CaSR antibody; cation sensing receptor; EIG8; Extracellular calcium-sensing receptor; FHH; FIH; G protein coupled receptor, family C, group 2, member A; G protein-coupled receptor, family C, group 2, member A; Gprc2a; HHC; HHC1; HYPOC1; LOW QUALITY PROTEIN: extracellular calcium-sensing receptor; NSHPT; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; Parathyroid cell calcium-sensing receptor 1; PCaR1
Gene CASR
Product Type Antibody
Gene ID (Entrez) 12374, 24247, 281038, 846
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Classification Monoclonal
Primary or Secondary Primary
Clone 5C10, ADD,ADD
4

Calcium-binding-protein-P22 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Form Purified
Isotype IgG
Research Discipline Wnt Signaling Pathway
Antigen Calcium-binding-protein-P22
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Gene Alias Calcineurin B homolog, Calcineurin homologous protein, calcium binding protein P22, Calcium-binding protein CHP, calcium-binding protein p22, SLC9A1 binding protein, SLC9A1BP
Gene ID (Entrez) 11261
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Calcium-binding-protein-P22 (NP_009167.1).,, Sequence:, MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Classification Polyclonal
Primary or Secondary Primary
5

Calcium Channel Flower Homolog Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Purified
Isotype IgG
Antigen Calcium Channel Flower Homolog
Regulatory Status RUO
Purification Method Immunogen affinity purified
Dilution Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Gene Alias CACFD1, calcium channel flower domain containing 1, calcium channel flower homolog, chromosome 9 open reading frame 7, D9S2135, FLOWER
Gene ID (Entrez) 11094
Formulation PBS (pH 7.2) and 40% Glycerol
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
Classification Polyclonal
Primary or Secondary Primary
6

calcium homeostasis modulator 2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen calcium homeostasis modulator 2
Gene Symbols CALHM2
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500
Gene Alias calcium homeostasis modulator 2, calcium homeostasis modulator protein 2, FAM26Bfamily with sequence similarity 26, member B, Protein FAM26B
Gene ID (Entrez) 51063
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RGEAYVCALSEFVDPSSLTAREEHFPSAHATEILARFPCKENPDNLSDFREEVSRRLRYESQ
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of human calcium homeostasis modulator 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
7

Calcium-binding-protein-P22 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Wnt Signaling Pathway
Antigen Calcium-binding-protein-P22
Gene Symbols CHP1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
Gene Alias Calcineurin B homolog, Calcineurin homologous protein, calcium binding protein P22, Calcium-binding protein CHP, calcium-binding protein p22, SLC9A1 binding protein, SLC9A1BP
Gene ID (Entrez) 11261
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNIS
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
8

Calcium-sensing R/CaSR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Cell Biology, Cellular Markers, Extracellular Matrix, GPCR, Growth and Development, Lipid and Metabolism, Neuroscience, Neurotransmission, Signal Transduction
Antigen Calcium-sensing R/CaSR
Regulatory Status RUO
Purification Method Immunogen affinity purified
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias calcium-sensing receptor, CAR, CaSR, EIG8, extracellular calcium-sensing receptor, FHH, FIH, GPRC2AHHC, HHC1, hypocalciuric hypercalcemia 1, NSHPT, parathyroid Ca(2+)-sensing receptor 1, Parathyroid cell calcium-sensing receptor, PCaR1, PCAR1MGC138441
Gene ID (Entrez) 846
Formulation PBS (pH 7.2) and 40% Glycerol
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGG
Classification Polyclonal
Primary or Secondary Primary
9

Calcium-sensing R/CaSR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 1 publication

Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P41180
Research Discipline Cytoskeleton Markers, Extracellular Matrix, GPCR, Growth and Development, Lipid and Metabolism, Neuroscience, Neurotransmission, Signal Transduction
Antigen Calcium-sensing R/CaSR
Gene Symbols CASR
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias calcium-sensing receptor, CAR, CaSR, EIG8, extracellular calcium-sensing receptor, FHH, FIH, GPRC2AHHC, HHC1, hypocalciuric hypercalcemia 1, NSHPT, parathyroid Ca(2+)-sensing receptor 1, Parathyroid cell calcium-sensing receptor, PCaR1, PCAR1MGC138441
Gene ID (Entrez) 846
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
10

Sodium-Calcium Exchanger Antibody (C2C12), Novus Biologicals™
SDP

Mouse Monoclonal Antibody has been used in 2 publications

Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot
Form Ascites
Isotype IgM
Concentration 1 mg/ml
Antigen Sodium-Calcium Exchanger
Gene Symbols SLC8A3
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:1000, Flow Cytometry 1:100, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 1:10 - 1:500, Immunohistochemistry-Paraffin 1:100, Immunohistochemistry-Frozen 1:100
Gene Alias Na(+)/Ca(2+)-exchange protein 3, Na+/Ca2+ exchanger 3, NCX3sodium/calcium exchanger SLC8A3, sodium/calcium exchanger 3, solute carrier family 8 (sodium/calcium exchanger), member 3, solute carrier family 8 (sodium-calcium exchanger), member 3
Gene ID (Entrez) 6547
Immunogen Purified canine cardiac sodium/calcium exchanger.
Classification Monoclonal
Primary or Secondary Primary
Test Specificity Sodium Calcium Exchanger (C2C12)
Clone C2C12
11

calcium homeostasis modulator 2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline Cell Biology
Antigen calcium homeostasis modulator 2
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000
Gene Alias calcium homeostasis modulator 2, calcium homeostasis modulator protein 2, FAM26Bfamily with sequence similarity 26, member B, Protein FAM26B
Gene ID (Entrez) 51063
Formulation PBS (pH 7.0)
Immunogen Produced in rabbits immunized with E. coli-derived Human calcium homeostasis modulator 2 fragment.
Classification Polyclonal
Primary or Secondary Primary
12

Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Calcium Activated Nucleotidase 1/CANT1
Gene Symbols CANT1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1
Gene ID (Entrez) 124583
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVK
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
13

Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 1 publication

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Lipid and Metabolism
Antigen Calcium Activated Nucleotidase 1/CANT1
Gene Symbols CANT1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1
Gene ID (Entrez) 124583
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVK
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
14

Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. Q8WVQ1
Research Discipline Lipid and Metabolism
Antigen Calcium Activated Nucleotidase 1/CANT1
Gene Symbols CANT1
Regulatory Status RUO
Gene Alias Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1
Gene ID (Entrez) 124583
Immunogen Synthetic peptides corresponding to CANT1(calcium activated nucleotidase 1) The peptide sequence was selected from the middle region of CANT1. Peptide sequence SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY.
Classification Polyclonal
Primary or Secondary Primary
15

Sodium Calcium Exchanger 1/NCX1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Antigen Sodium Calcium Exchanger 1/NCX1
Gene Symbols SLC8A1
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias FLJ37694, FLJ43417, Na(+)/Ca(2+)-exchange protein 1, sodium/calcium exchanger 1, solute carrier family 8 (sodium/calcium exchanger), member 1
Gene ID (Entrez) 6546
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.