accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,582)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

potassium

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (3)
  • (47)
  • (15)
  • (7)
  • (2)
  • (1)
  • (3)
  • (12)
  • (8)
  • (6)
  • (1)
  • (160)
  • (7)
  • (1)
  • (534)
  • (1)
  • (43)
  • (374)
  • (20)
  • (3)
  • (11)
  • (4)
  • (3)
  • (843)

special interests

  • (21)
  • (10)
  • (588)

Classification

  • (309)
  • (996)
  • (13)
  • (1)

Host Species

  • (3)
  • (29)
  • (12)
  • (285)
  • (983)
  • (4)
  • (2)

Quantity

  • (8)
  • (1)
  • (4)
  • (1)
  • (1)
  • (185)
  • (5)
Show all

Target Species

  • (1)
  • (120)
  • (116)
  • (12)
  • (2)
  • (1)
  • (27)
Show all

Conjugate

  • (16)
  • (1)
  • (6)
  • (4)
  • (6)
  • (6)
  • (1)
Show all

Applications

  • (1)
  • (10)
  • (1)
  • (2)
  • (7)
  • (107)
  • (171)
Show all

Isotype

  • (2)
  • (987)
  • (148)
  • (52)
  • (50)
  • (8)
  • (15)
Show all

Regulatory Status

  • (1,246)

Form

  • (2)
  • (6)
  • (848)
  • (52)
  • (263)
  • (7)
  • (1)
1 – 15 of 1,503 results
1

Potassium Channel Kv3.1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Research Discipline Neuronal Cell Markers, Neuroscience, Neurotransmission, Phospho Specific, Potassium Channels
Antigen Potassium Channel Kv3.1
Regulatory Status RUO
Purification Method Ammonium sulfate precipitation
Dilution Western Blot : 5-10 μg/mL
Gene Alias FLJ41162, FLJ42249, FLJ43491, KV3.1, KV4, MGC129855, NGK2, potassium voltage-gated channel subfamily C member 1, potassium voltage-gated channel, Shaw-related subfamily, member 1, voltage-gated potassium channel protein KV3.1, Voltage-gated potassium channel subunit Kv3.1, Voltage-gated potassium channel subunit Kv4
Gene ID (Entrez) 3746
Formulation Phosphate buffered saline
Immunogen Rabbits were immunized with a synthetic peptide derived from the rat Potassium Channel Kv3.1 conjugated to KLH
Classification Polyclonal
Primary or Secondary Primary
2

Potassium Channel Kv2.2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Research Discipline Autophagy, Neuronal Cell Markers, Neuroscience, Neurotransmission, Potassium Channels
Antigen Potassium Channel Kv2.2
Gene Symbols KCNB2
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias delayed rectifier potassium channel protein, KV2.2, potassium channel Kv2.2, potassium voltage-gated channel subfamily B member 2, potassium voltage-gated channel, Shab-related subfamily, member 2, voltage-gated potassium channel subunit Kv2.2
Gene ID (Entrez) 9312
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHISTILLEETPSQGDRPLLGTEVSAPCQGPSKGLSPRFPKQKLFPFSSRERRSFTEIDTGDDEDFLELP
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
3

Potassium Channel Kv3.1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P48547
Research Discipline Neuronal Cell Markers, Neuroscience, Neurotransmission, Potassium Channels
Antigen Potassium Channel Kv3.1
Gene Symbols KCNC1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias FLJ41162, FLJ42249, FLJ43491, KV3.1, KV4, MGC129855, NGK2, potassium voltage-gated channel subfamily C member 1, potassium voltage-gated channel, Shaw-related subfamily, member 1, voltage-gated potassium channel protein KV3.1, Voltage-gated potassium channel subunit Kv3.1, Voltage-gated potassium channel subunit Kv4
Gene ID (Entrez) 3746
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDS
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
4

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Gene ID (Entrez) 496
Immunogen Synthetic peptide directed towards the C terminal of human Atp4b. Peptide sequence QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL.
Classification Polyclonal
Isotype IgG
Gene Accession No. NP_036642
Primary or Secondary Primary
5

Maxi Potassium channel beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 5 publications

Content And Storage Store at -20°C. Avoid freeze/thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. Q16558
Research Discipline Potassium Channels
Concentration 1 mg/mL
Antigen Maxi Potassium channel beta
Gene Symbols KCNMB1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 2.0 μg/mL, Flow Cytometry, Immunohistochemistry 1:200 - 1:2000, Immunocytochemistry/Immunofluorescence 1:100 - 1:200, Immunohistochemistry-Paraffin 1:200 - 1:2000, Knockdown Validated
Gene Alias BK channel beta subunit, BK channel subunit beta-1, BKbeta, BKbeta1, Calcium-activated potassium channel subunit beta, calcium-activated potassium channel subunit beta-1, Calcium-activated potassium channel, subfamily M subunit beta-1, Charybdotoxin receptor subunit beta-1, Hbeta1, hslo-beta, K(VCA)beta, k(VCA)beta-1, large conductance Ca2+-activated K+ channel beta 1 subunit, Maxi K channel beta subunit, Maxi K channel subunit beta-1, potassium large conductance calcium-activated channel, subfamily M, beta member1, Slo-beta, Slo-beta-1
Gene ID (Entrez) 3779
Formulation PBS, 1 mg/ml BSA with 0.05% Sodium Azide
Immunogen Synthetic Peptide: L(90) Y H T E D T R D Q N Q Q C(103)
Classification Polyclonal
Primary or Secondary Primary
6

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Purified
Isotype IgG
Research Discipline Endocrinology, Signal Transduction
Antigen Hydrogen Potassium ATPase Beta
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500 - 1:2000, ELISA
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 62-291 of human Hydrogen Potassium ATPase Beta (NP_000696.1).,, Sequence:, LMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Classification Polyclonal
Primary or Secondary Primary
7

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P51164
Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
8

Maxi Potassium channel alpha Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. Q12791
Research Discipline Potassium Channels
Antigen Maxi Potassium channel alpha
Gene Symbols KCNMA1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias bA205K10.1, BK channel, BKCA alpha, BKCA alpha subunit, BKTM, calcium-activated potassium channel subunit alpha-1, DKFZp686K1437, hSlo, k(VCA)alpha, KCNMA, Maxi K channel, MaxiK, MGC71881, potassium large conductance calcium-activated channel, subfamily M, alphamember 1, SAKCA, Slo homolog, Slo1, SLO-ALPHA, Slowpoke homolog, stretch-activated Kca channel, subfamily M subunit alpha-1
Gene ID (Entrez) 3778
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: INLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQP
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
9

Maxi Potassium channel alpha Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Host Species Rabbit
Conjugate Unconjugated
Form Antisera
Isotype IgG
Gene Accession No. Q62976
Research Discipline Potassium Channels
Concentration LYOPH
Antigen Maxi Potassium channel alpha
Gene Symbols KCNMA1
Regulatory Status RUO
Purification Method Unpurified
Gene Alias bA205K10.1, BK channel, BKCA alpha, BKCA alpha subunit, BKTM, calcium-activated potassium channel subunit alpha-1, DKFZp686K1437, hSlo, k(VCA)alpha, KCNMA, Maxi K channel, MaxiK, MGC71881, potassium large conductance calcium-activated channel, subfamily M, alphamember 1, SAKCA, Slo homolog, Slo1, SLO-ALPHA, Slowpoke homolog, stretch-activated Kca channel, subfamily M subunit alpha-1
Gene ID (Entrez) 3778
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Rat, mouse. Other species not yet tested.
10

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. P51164
Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Molecular Weight of Antigen 33 kDa
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Immunogen Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK.
Classification Polyclonal
Primary or Secondary Primary
Test Specificity This product is specific to Subunit or Isoform: beta.
11

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P51164
Antigen Hydrogen Potassium ATPase Beta
Gene Symbols ATP4B
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene ID (Entrez) 496
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
12

Sodium Potassium ATPase Alpha 3 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications ELISA,Western Blot
Form Purified
Isotype IgG
Antigen Sodium Potassium ATPase Alpha 3
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:500 - 1:2000, ELISA
Gene Alias alpha 3 polypeptide, ATPase, Na+/K+ transporting, alpha 3 polypeptide, dystonia 12, DYT12, EC 3.6.3, MGC13276, RDP, Sodium pump subunit alpha-3, sodium/potassium-transporting ATPase alpha-3 chain, sodium/potassium-transporting ATPase subunit alpha-3
Gene ID (Entrez) 478
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human Sodium Potassium ATPase Alpha 3 (NP_689509.1).,, Sequence:, MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Classification Polyclonal
Primary or Secondary Primary
13

Sodium Potassium ATPase Alpha 3 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Antigen Sodium Potassium ATPase Alpha 3
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Immunohistochemistry-Paraffin 1:200-1:1000
Gene Alias alpha 3 polypeptide, ATPase, Na+/K+ transporting, alpha 3 polypeptide, dystonia 12, DYT12, EC 3.6.3, MGC13276, RDP, Sodium pump subunit alpha-3, sodium/potassium-transporting ATPase alpha-3 chain, sodium/potassium-transporting ATPase subunit alpha-3
Gene ID (Entrez) 478
Formulation PBS (pH 7.0)
Immunogen Produced in rabbits immunized with a synthetic peptide corresponding to the N-terminus of the Mouse Sodium Potassium ATPase Alpha 3.
Classification Polyclonal
Primary or Secondary Primary
14

Sodium Potassium ATPase Beta 1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline Cancer, Cellular Markers, Growth and Development, Hypoxia, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction
Antigen Sodium Potassium ATPase Beta 1
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Western Blot 1:500-1:2000, Immunohistochemistry-Paraffin 1:1000-1:4000
Gene Alias adenosinetriphosphatase, ATP1B, ATPase, Na+/K+ transporting, beta 1 polypeptide, Beta 1-subunit of Na(+), K(+)-ATPase, MGC1798, Na, K-ATPase beta-1 polypeptide, sodium/potassium-dependent ATPase beta-1 subunit, Sodium/potassium-dependent ATPase subunit beta-1, sodium/potassium-transporting ATPase beta-1 chain, sodium/potassium-transporting ATPase subunit beta-1
Gene ID (Entrez) 481
Formulation 0.2 um filtered solution in PBS
Immunogen Produced in rabbits immunized with purified, recombinant Human Sodium Potassium ATPase Beta 1 (Accession#: P05026-1; Glu63-Ser303)
Classification Polyclonal
Primary or Secondary Primary
15

MilliporeSigma™ Potassium Channel Kir3.4, Mouse, Unlabeled, Clone: 8F4.1,

Mouse Monoclonal Antibody

Antigen Potassium Channel Kir3.4
Regulatory Status RUO
Content And Storage Stable for 1 year at 2°-8°C from date of receipt.
Host Species Mouse
Applications Western Blot
Form Purified
Formulation Purified mouse IgG1 in buffer containing 0.1M Tris-Glycine (pH 7.4), 150mM NaCl with 0.05% Sodium Azide.
Classification Monoclonal
Primary or Secondary Primary
Clone 8F4.1